Parathyroid Hormone 2 (PTH2) anticorps
-
- Antigène Voir toutes Parathyroid Hormone 2 (PTH2) Anticorps
- Parathyroid Hormone 2 (PTH2)
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- ELISA, Radioimmunoassay (RIA)
- Specificité
- Human, bovine, canis TIP 39
- Immunogène
- synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)
-
anti-Parathyroid Hormone 2 (PTH2) (C-Term) antibody
PTH2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Singe, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Parathyroid Hormone 2 (PTH2) (Middle Region) antibodyPTH2 Reactivité: Hormone WB Hôte: Lapin Polyclonal unconjugated
anti-Parathyroid Hormone 2 (PTH2) (Middle Region) antibodyPTH2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
- ELISA (1/4.000) RIA (1/ 2.000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Resuspend in aqua bidest.
- Stock
- 4 °C
-
- Antigène
- Parathyroid Hormone 2 (PTH2)
- Autre désignation
- TIP 39 (PTH2 Produits)
- Synonymes
- anticorps TIP39, anticorps Tifp39, anticorps Tip39, anticorps RGD1559447, anticorps pth2, anticorps parathyroid hormone 2, anticorps parathyroid hormone 1b, anticorps tuberoinfundibular 39 residue protein, anticorps PTH2, anticorps Pth2, anticorps pth1b, anticorps TIP39
- Sujet
- Serum
- Pathways
- Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-
