BNP32 anticorps
-
- Antigène Voir toutes BNP32 (BNP 32) Anticorps
- BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BNP32 est non-conjugé
-
Application
- ELISA, Immunohistochemistry (IHC), Dot Blot (DB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Marque
- IHC-plus™
- Purification
- Protein G purified
- Immunogène
-
Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH
Type of Immunogen: Synthetic peptide - KLH conjugated - Isotype
- IgG
-
-
- Indications d'application
- Approved: DB, ELISA (1:40000), IHC, IHC-P (10 μg/mL)
- Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Reconstitute at 1 mg/mL in PBS
- Concentration
- Lot specific
- Buffer
- Lyophilized from PBS. No preservative added
- Agent conservateur
- Without preservative
-
- Antigène
- BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))
- Abstract
- BNP 32 Produits
- Synonymes
- anticorps BNP, anticorps natriuretic peptide B, anticorps NPPB
-