ACBD4 anticorps (N-Term)
-
- Antigène Voir toutes ACBD4 Anticorps
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Boeuf (Vache), Chien, Poisson zèbre (Danio rerio), Xenopus laevis, Poulet
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACBD4 est non-conjugé
-
Application
- Western Blotting (WB)
- Séquence
- MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT
- Réactivité croisée (Details)
- Species reactivity (expected):Mouse, Rat, Bovine, Dog, African clawed frog, Zebrafish, ChickenSpecies reactivity (tested):Human
- Purification
- Purified using peptide immunoaffinity column
- Immunogène
- Synthetic peptide directed towards the N terminal of human ACBD4
- Top Product
- Discover our top product ACBD4 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Antigène
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
- Autre désignation
- ACBD4 (ACBD4 Produits)
- Synonymes
- anticorps zgc:85611, anticorps F22F7.13, anticorps F22F7_13, anticorps acyl-CoA binding protein 4, anticorps 2010009P05Rik, anticorps 2010015A21Rik, anticorps AI849317, anticorps acyl-CoA binding domain containing 4, anticorps acyl-CoA binding protein 4, anticorps acyl-Coenzyme A binding domain containing 4, anticorps ACBD4, anticorps acbd4, anticorps Acbd4, anticorps ACBP4
- Sujet
- ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.Synonyms: Acyl-CoA-binding domain-containing protein 4, HMFT0700
- ID gène
- 79777
- NCBI Accession
- NP_078998
-