HOXC4 anticorps (N-Term)
-
- Antigène Voir toutes HOXC4 Anticorps
- HOXC4 (Homeobox C4 (HOXC4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien, Boeuf (Vache)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HOXC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Séquence
- MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ
- Réactivité croisée (Details)
- Species reactivity (expected):Mouse, Rat, Dog, Zebrafish, BovineSpecies reactivity (tested):Human
- Purification
- Purified on Protein A affinity column.
- Immunogène
- The immunogen for anti-HOXC4 antibody: synthetic peptide directed towards the N terminal of human HOXC4.
- Top Product
- Discover our top product HOXC4 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 100 μL of distilled water
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- -20 °C
- Stockage commentaire
- Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.
- Date de péremption
- 12 months
-
- Antigène
- HOXC4 (Homeobox C4 (HOXC4))
- Autre désignation
- HOXC4 / HOX3E (HOXC4 Produits)
- Synonymes
- anticorps HOXC4, anticorps Hox3r3, anticorps hoxc4, anticorps z-96, anticorps zgc:110513, anticorps HOX3, anticorps HOX3E, anticorps cp19, anticorps Hox-3.5, anticorps homeobox C4, anticorps homeo box C4, anticorps homeobox C4a, anticorps hoxc4, anticorps HOXC4, anticorps Hoxc4, anticorps hoxc4a
- Sujet
- HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5' non-coding exon.Synonyms: CP19, Homeobox protein Hox-C4, Hox-3E
- ID gène
- 3221
- NCBI Accession
- NP_705897
-