SNF8 anticorps (N-Term)
-
- Antigène Voir toutes SNF8 Anticorps
- SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris, Boeuf (Vache), Chien, Poisson zèbre (Danio rerio), Xenopus laevis, Poulet
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SNF8 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Séquence
- MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
- Réactivité croisée (Details)
- Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human
- Purification
- Purified on peptide immunoaffinity column
- Immunogène
- The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
- Top Product
- Discover our top product SNF8 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- -20 °C
- Stockage commentaire
- Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.
- Date de péremption
- 12 months
-
- Antigène
- SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))
- Autre désignation
- Vacuolar-Sorting Protein SNF8 (SNF8 Produits)
- Synonymes
- anticorps d11moh34, anticorps vps22, anticorps Dot3, anticorps EAP30, anticorps VPS22, anticorps D11moh34, anticorps RGD1310144, anticorps D11Moh34, anticorps D11MOH34, anticorps zgc:101578, anticorps SNF8, ESCRT-II complex subunit, anticorps eap30 subunit of ell complex, putative, anticorps EAP30 subunit of ELL complex, anticorps SNF8, ESCRT-II complex subunit S homeolog, anticorps SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae), anticorps snf8, anticorps TA17290, anticorps TVAG_107410, anticorps Bm1_05145, anticorps SNF8, anticorps Snf8, anticorps snf8.S
- Sujet
- ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22
- ID gène
- 11267
- NCBI Accession
- NP_009172
-