ZNF76 anticorps (Middle Region)
-
- Antigène Voir toutes ZNF76 Anticorps
- ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien, Boeuf (Vache), Porc
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZNF76 est non-conjugé
-
Application
- Western Blotting (WB)
- Séquence
- MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK
- Réactivité croisée (Details)
- Species reactivity (expected):Mouse, Rat, Pig, Bovine, DogSpecies reactivity (tested):Human
- Purification
- Purified using peptide immunoaffinity column
- Immunogène
- The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the middle region of human ZNF76
- Top Product
- Discover our top product ZNF76 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Antigène
- ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))
- Autre désignation
- ZNF76 (ZNF76 Produits)
- Synonymes
- anticorps 2810027J07, anticorps BC025615, anticorps Znf76, anticorps D6S229E, anticorps ZNF523, anticorps Zfp523, anticorps zinc finger protein 523, anticorps zinc finger protein 76, anticorps Zfp523, anticorps ZNF76
- Sujet
- ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF76 may be involved in transcriptional regulation.Synonyms: D6S229E, ZNF523, Zinc finger protein 523, Zinc finger protein 76
- ID gène
- 7629
- NCBI Accession
- NP_003418
-