ZNF93 anticorps
-
- Antigène Voir toutes ZNF93 Anticorps
- ZNF93 (Zinc Finger Protein 93 (ZNF93))
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio), Boeuf (Vache), Xenopus laevis
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZNF93 est non-conjugé
-
Application
- Western Blotting (WB)
- Réactivité croisée (Details)
- Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine
- Purification
- Purified using peptide immunoaffinity column
- Immunogène
- A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC
- Top Product
- Discover our top product ZNF93 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Concentration
- 1.0 mg/mL after reconstitution
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Antigène
- ZNF93 (Zinc Finger Protein 93 (ZNF93))
- Autre désignation
- ZNF93 (ZNF93 Produits)
- Synonymes
- anticorps ZNF354A, anticorps MGC143044, anticorps HPF34, anticorps HTF34, anticorps TF34, anticorps ZNF505, anticorps Znf235, anticorps zinc finger protein 93, anticorps ZNF93, anticorps Zfp93
- Sujet
- ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34
- Poids moléculaire
- 71 kDa (620 aa)
- ID gène
- 81931
- NCBI Accession
- NP_112495
-