Ataxin 1 anticorps (AA 164-197) (HRP)
-
- Antigène Voir toutes Ataxin 1 (ATXN1) Anticorps
- Ataxin 1 (ATXN1)
-
Épitope
- AA 164-197
-
Reactivité
- Souris
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp Ataxin 1 est conjugé à/à la HRP
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Specificité
- Detects ~85 kDa.
- Réactivité croisée
- Humain, Souris, Rat
- Purification
- Protein G Purified
- Immunogène
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
- Clone
- S76-8
- Isotype
- IgG2b
- Top Product
- Discover our top product ATXN1 Anticorps primaire
-
-
- Indications d'application
-
- WB (1:1000)
- ICC/IF (1:100)
- optimal dilutions for assays should be determined by the user.
- Commentaires
-
1 μg/ml of ABIN1741210 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 1 mg/mL
- Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C
- Stockage commentaire
- Conjugated antibodies should be stored at 4°C
-
- Antigène
- Ataxin 1 (ATXN1)
- Autre désignation
- Ataxin 1 (ATXN1 Produits)
- Synonymes
- anticorps ATX1, anticorps D6S504E, anticorps SCA1, anticorps ATXN1, anticorps ataxin 1b, anticorps atxn1, anticorps 2900016G23Rik, anticorps Atx1, anticorps C85907, anticorps ENSMUSG00000074917, anticorps Gm10786, anticorps Sca1, anticorps CG4547, anticorps Dmel\\CG4547, anticorps dAtx-1, anticorps dAtx1, anticorps sca1, anticorps ataxin 1, anticorps ataxin 1b, anticorps Ataxin 1, anticorps ATXN1, anticorps atxn1b, anticorps Atxn1, anticorps Atx-1
- Sujet
- Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
- ID gène
- 20238
- NCBI Accession
- NP_001186233
- UniProt
- P54254
- Pathways
- Synaptic Membrane
-