SRA1 anticorps (AA 519-556)

N° du produit ABIN1742561

Détail du produit anti-SRA1 anticorps

Antigène: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Épitope: AA 519-556

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp SRA1 est non-conjugé

Application: Western Blotting (WB), ELISA, Immunoprecipitation (IP)

Specificité: Specific for Sra 1

Réactivité croisée (Details): may cross-react with CYFIP 2/PIR 121 due to high sequence homology.

Purification: purified IgG. Azide was added before lyophilization.

Immunogène: Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.

Clone: 30A4

Isotype: IgG1

Information d'application

Indications d'application: WB: 1 : 100 up to 1 : 2000 (AP staining)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: For reconstitution add 100 µL H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20 °C until use.

Buffer: PBS, 0.02% sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Do not store diluted antibody solutions unless you add detergent or carrier proteins such as goat serum, BSA or others. IgG sticks to glass and plastic. Any IgG solution below 0.1 mg/mL protein will quickly adsorb and denature and thus loose activity! Repetitive freeze-thawing of dilute purified IgG is almost certain to lead to substantial losses.

Stock: -20 °C

Stockage commentaire: Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.

Références pour anticorps anti-SRA1 (ABIN1742561)

Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." dans: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." dans: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).

Détails sur SRA1

Antigène: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Autre désignation: Sra 1 (SRA1 Produits)

Synonymes: anticorps SRA, anticorps SRAP, anticorps STRAA1, anticorps pp7684, anticorps AA959952, anticorps Sra, anticorps Srap, anticorps Straa1, anticorps Strra1, anticorps zgc:86613, anticorps steroid receptor RNA activator 1, anticorps steroid receptor RNA activator 1 S homeolog, anticorps cytoplasmic FMR1 interacting protein 1, anticorps SRA1, anticorps Sra1, anticorps sra1, anticorps sra1.S, anticorps CYFIP1

Sujet: Synonyms: CYFIP 1

Pathways: EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development