NMS anticorps (AA 70-103)
-
- Antigène Voir toutes NMS Anticorps
- NMS (Neuromedin S (NMS))
-
Épitope
- AA 70-103
-
Reactivité
- Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NMS est non-conjugé
-
Application
- ELISA
- Specificité
- Mouse Neuromedin S.
- Purification
- Protein A purified
- Immunogène
-
Synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS).
Type of Immunogen: Synthetic peptide - Isotype
- IgG
- Top Product
- Discover our top product NMS Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
-
Target Species of Antibody: Mouse
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- PBS
- Concentration
- Lot specific
- Buffer
- Lyophilized from PBS, pH 7
- Conseil sur la manipulation
- Aliquot to avoid repeated freezing and thawing.
- Stock
- -20 °C
- Stockage commentaire
- Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
-
- Antigène
- NMS (Neuromedin S (NMS))
- Autre désignation
- NMS (NMS Produits)
- Sujet
-
Name/Gene ID: NMS
Synonyms: NMS, FLGRACILE, Neuromedin-S, Neuromedin S, PTD, BJS - ID gène
- 129521
- UniProt
- Q5H8A3
-