PTH anticorps (N-Term)
-
- Antigène Voir toutes PTH Anticorps
- PTH (Parathyroid Hormone (PTH))
-
Épitope
- AA 1-38, N-Term
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp PTH est non-conjugé
-
Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)
- Specificité
- This antibody detects Human PTH (aa 15-25, 1-34, 1-38, 1-84, 7-84). There was no cross-reactivity obtained with synthetic Human PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84), or with PTHrP (aa 1-86).
- Attributs du produit
- Synonyms: Parathormone, Parathyrin
- Purification
- Affinity chromatography
- Immunogène
- Synthetic human PTH (aa 1-38) poly Lysin conjugatedAA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
- Clone
- B2-82
- Isotype
- IgG1
- Top Product
- Discover our top product PTH Anticorps primaire
-
-
- Indications d'application
-
RIA (25 ng/mL). Immunohistochemistry (cryo sections and paraffin sections, 2 μg/mL). ELISA (1 μg/mL).
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user. - Restrictions
- For Research Use only
-
- Reconstitution
- Restore in aqua bidest to 1 mg/mL.
- Buffer
- 50 mM TRIS, pH 7.4, 0.05 % Sodium Azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch. - Date de péremption
- 12 months
-
- Antigène
- PTH (Parathyroid Hormone (PTH))
- Autre désignation
- Parathyroid Hormone / PTH (PTH Produits)
- Synonymes
- anticorps PTH1, anticorps Pthp, anticorps PTH-(1-84), anticorps Pth1, anticorps Pthr1, anticorps PTH, anticorps parathyroid hormone, anticorps parathyroid hormone S homeolog, anticorps PTH, anticorps Pth, anticorps pth.S
- Classe de substances
- Hormone
- Sujet
- Synonyms: Parathormone, Parathyrin
- ID gène
- 5741
- UniProt
- P01270
- Pathways
- cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process
-