beta 2 Defensin anticorps (AA 4-41)
(1 reference)-
- Antigène Voir toutes beta 2 Defensin (BD-2) Anticorps
- beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))
-
Épitope
- AA 4-41
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp beta 2 Defensin est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Enzyme Immunoassay (EIA)
- Specificité
- This antibody recognizes Human beta-Defensin 2 (aa 4-41).
- Attributs du produit
- Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A
- Purification
- Protein G Chromatography
- Immunogène
- Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
- Clone
- L12-4C-C2
- Isotype
- IgG1
- Top Product
- Discover our top product BD-2 Anticorps primaire
-
anti-Defensin beta 2 (BD-2) (AA 24-64) antibody
BD-2 Reactivité: Humain WB, ELISA, IHC (p), ICC, IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 21-71) antibodyBD-2 Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 21-71) antibodyBD-2 Reactivité: Souris IF (cc), IF (p), ELISA, IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) antibody (Biotin)BD-2 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal Biotin
anti-Defensin beta 2 (BD-2) (AA 23-63) antibodyBD-2 Reactivité: Rat WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 21-71) antibodyBD-2 Reactivité: Humain, Rat WB, IF (cc), IF (p), ELISA, IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 4-41) antibodyBD-2 Reactivité: Humain WB, ELISA, IHC (p) Hôte: Souris Monoclonal L12-4C-C2 unconjugated
-
- Indications d'application
-
ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user. - Restrictions
- For Research Use only
-
- Reconstitution
- Restore in 0.1 mL aqua bidest to 1 mg/mL.
- Buffer
- 50 mM TRIS pH 7.4
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch. - Date de péremption
- 12 months
-
-
: "Towards the development of a RNAi-based topical treatment for psoriasis: Proof-of-concept in a 3D psoriasis skin model." dans: Experimental dermatology, (2018) (PubMed).
-
: "Towards the development of a RNAi-based topical treatment for psoriasis: Proof-of-concept in a 3D psoriasis skin model." dans: Experimental dermatology, (2018) (PubMed).
-
- Antigène
- beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))
- Autre désignation
- Defensin beta 2 (BD-2 Produits)
- Synonymes
- anticorps BD-2, anticorps BD-4, anticorps DEFB-4, anticorps hBD-4, anticorps BD2, anticorps DEFB2, anticorps defensin beta 2, anticorps defensin beta 104B, anticorps beta defensin 2, anticorps Defb2, anticorps DEFB104B, anticorps SBD2
- Sujet
- This antibiotic peptide is locally regulated by inflammation. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence.Synonyms: BD-2, Beta-defensin 2, Beta-defensin 4A, DEFB102, DEFB2, DEFB4A, DEFB4B, Skin-antimicrobial peptide 1, hBD-2
- ID gène
- 100289462
- UniProt
- O15263
-
