TLR8 anticorps (N-Term)
-
- Antigène Voir toutes TLR8 Anticorps
- TLR8 (Toll-Like Receptor 8 (TLR8))
-
Épitope
- AA 81-109, N-Term
-
Reactivité
- Humain
-
Hôte
- Chèvre
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TLR8 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- TLR8 antibody was purified by affinity chromatography
- Immunogène
- TLR8 antibody was raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 as the immunogen
- Top Product
- Discover our top product TLR8 Anticorps primaire
-
-
- Indications d'application
- IHC: 1:125, WB: 1:500
- Restrictions
- For Research Use only
-
- Concentration
- Lot specific
- Buffer
- 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles
- Stock
- -20 °C
- Stockage commentaire
- Aliquot and freeze at -20 °C
-
- Antigène
- TLR8 (Toll-Like Receptor 8 (TLR8))
- Autre désignation
- TLR8 (TLR8 Produits)
- Synonymes
- anticorps CD288, anticorps toll like receptor 8, anticorps toll-like receptor 8, anticorps TLR8, anticorps Tlr8
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades
-