Integrin alpha 3a anticorps (Cytoplasmic Domain)

N° du produit ABIN2295550

Détail du produit anti-Integrin alpha 3a anticorps

Antigène: Integrin alpha 3a

Épitope: Cytoplasmic Domain

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3a est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Séquence: CRTRALYEAK RQKAEMKSQP SETERLTDDY

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: Integrin alpha 3A

Purification: Purified by Protein G affinity chromatography.

Immunogène: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Clone: 29A3

Isotype: IgG1

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur Integrin alpha 3a

Antigène: Integrin alpha 3a

Abstract: Integrin alpha 3a Produits