Integrin alpha 3b anticorps (N-Term)

N° du produit ABIN2295556

Cet anticorps Souris Monoclonal détecte spécifiquement Integrin alpha 3b dans IHC, WB et IC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Integrin alpha 3b anticorps (N-Term) (ABIN2295556)

Antigène: Integrin alpha 3b

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3b est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Clone: 54B3

Détail du produit anti-Integrin alpha 3b anticorps

Épitope: N-Term

Séquence: CTRYYQIMPK YHAVRIREEE RYPPPGSTLP TKK

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: Integrin alpha 3B

Purification: Purified by Protein G affinity chromatography.

Immunogène: Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH

Isotype: IgG1

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur Integrin alpha 3b

Antigène: Integrin alpha 3b