ABCC9 anticorps (AA 1505-1546) (Biotin)
-
- Antigène Voir toutes ABCC9 Anticorps
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
-
Épitope
- AA 1505-1546
-
Reactivité
- Souris
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp ABCC9 est conjugé à/à la Biotin
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)
- Specificité
- Detects ~120 kDa. Does not cross-react with SUR2B.
- Réactivité croisée
- Humain, Souris, Rat
- Purification
- Protein G Purified
- Immunogène
- Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
- Clone
- S319A-14
- Isotype
- IgG2a
- Top Product
- Discover our top product ABCC9 Anticorps primaire
-
-
- Indications d'application
-
- WB (1:1000)
- optimal dilutions for assays should be determined by the user.
- Commentaires
-
1 μg/ml of ABIN2482978 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 1 mg/mL
- Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C
- Stockage commentaire
- Conjugated antibodies should be stored at 4°C
-
- Antigène
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
- Autre désignation
- SUR2A (ABCC9 Produits)
- Synonymes
- anticorps SUR2B, anticorps DDBDRAFT_0215814, anticorps DDBDRAFT_0216237, anticorps DDB_0215814, anticorps DDB_0216237, anticorps si:dkey-183c2.3, anticorps sur2, anticorps ABC37, anticorps ATFB12, anticorps CANTU, anticorps CMD1O, anticorps SUR2, anticorps SUR2A, anticorps AI414027, anticorps AI449286, anticorps Sur2, anticorps ABCC9, anticorps ATP binding cassette subfamily C member 9, anticorps ATP-binding cassette sub-family C member 8, anticorps ABC transporter C family protein, anticorps ATP-binding cassette sub-family C member 9, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 9, anticorps ABCC9, anticorps LOC581821, anticorps abcC9, anticorps LOC100470981, anticorps abcc9, anticorps Abcc9
- Sujet
- Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
- ID gène
- 20928
- NCBI Accession
- NP_001038185
- UniProt
- P70170
-