VEGFA anticorps
-
- Antigène Voir toutes VEGFA Anticorps
- VEGFA (Vascular Endothelial Growth Factor A (VEGFA))
-
Reactivité
- Humain, Rat, Souris, Porc, Chien, Lapin, Poulet, Boeuf (Vache), Mouton, Cobaye, Cheval, Singe, Cat, Âne, Chévre, Hamster
-
Hôte
- Chèvre
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VEGFA est non-conjugé
-
Application
- Western Blotting (WB), Immunofluorescence (IF)
- Specificité
- Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.
- Purification
- Immunoaffinity purified
- Immunogène
- Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)
- Isotype
- IgG
- Top Product
- Discover our top product VEGFA Anticorps primaire
-
-
- Indications d'application
- Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)
- Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- PBS, 20 % glycerol, 0.05 % sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
-
- Antigène
- VEGFA (Vascular Endothelial Growth Factor A (VEGFA))
- Autre désignation
- VEGFA / VEGF (VEGFA Produits)
- Synonymes
- anticorps MVCD1, anticorps VEGF, anticorps VPF, anticorps Vegf, anticorps Vegf120, anticorps Vegf164, anticorps Vegf188, anticorps Vpf, anticorps vegf, anticorps vegfa, anticorps wu:fj82c06, anticorps VEGF-A, anticorps VEGF164, anticorps eVEGF120, anticorps eVEGF164, anticorps vegf-a, anticorps vpf, anticorps vefg, anticorps si:dkey-14d8.3, anticorps wu:fd42e02, anticorps vascular endothelial growth factor A, anticorps vascular endothelial growth factor Aa, anticorps vascular endothelial growth factor A L homeolog, anticorps vascular endothelial growth factor Ab, anticorps VEGFA, anticorps Vegfa, anticorps vegfaa, anticorps vegfa.L, anticorps vegfa, anticorps vegfab
- Sujet
-
Name/Gene ID: VEGFA
Family: PDGF
Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1 - ID gène
- 7422
- UniProt
- P15692
- Pathways
- Signalisation RTK, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling
-