ACTH anticorps (Middle Region)
-
- Antigène Voir toutes ACTH Anticorps
- ACTH (Adrenocorticotropic hormone (ACTH))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTH est non-conjugé
-
Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogène
- An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ACTH Anticorps primaire
-
-
- Indications d'application
- The stated application concentrations are suggested starting amounts. Titration of the ACTH antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the ACTH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- ACTH (Adrenocorticotropic hormone (ACTH))
- Autre désignation
- ACTH (ACTH Produits)
- Synonymes
- anticorps ACTH, anticorps BE, anticorps Beta-LPH, anticorps Clip, anticorps Gamma-LPH, anticorps Npp, anticorps Pomc-1, anticorps Pomc1, anticorps alpha-MSH, anticorps alphaMSH, anticorps beta-MSH, anticorps gamma-MSH, anticorps CLIP, anticorps LPH, anticorps MSH, anticorps NPP, anticorps POC, anticorps pro-opiomelanocortin-alpha, anticorps proopiomelanocortin, anticorps Pomc, anticorps POMC
- Classe de substances
- Hormone
- Sujet
- Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.
- ID gène
- 5443
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity
-