MEFV anticorps (N-Term)
-
- Antigène Voir toutes MEFV Anticorps
- MEFV (Mediterranean Fever (MEFV))
-
Épitope
- AA 5-39, N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MEFV est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Pyrin(MEFV) detection. Tested with WB in Human,Rat.
- Séquence
- PSDHLLSTLE ELVPYDFEKF KFKLQNTSVQ KEHSR
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Pyrin(MEFV) detection. Tested with WB in Human,Rat.
Gene Name: Mediterranean fever
Protein Name: Pyrin - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by eleven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product MEFV Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- MEFV (Mediterranean Fever (MEFV))
- Autre désignation
- MEFV (MEFV Produits)
- Synonymes
- anticorps pyrin, anticorps MEFV, anticorps FMF, anticorps MEF, anticorps TRIM20, anticorps rfp domain, anticorps MEFV, pyrin innate immunity regulator, anticorps Mediterranean fever, anticorps MEFV, anticorps Mefv
- Sujet
-
MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin). Pyrin is produced in certain white blood cells (neutrophils, eosinophils and monocytes) that play a role in inflammation and in fighting infection. Inside these white blood cells, pyrin is found with thecytoskeleton, the structural framework that helps to define the shape, size, and movement of a cell. Pyrin's protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response. Although pyrin's function is not fully understood, it likely assists in keeping the inflammation process under control. Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton. And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed.
Synonyms: FMF antibody|Marenostrin antibody|Mediterranean fever antibody|Mediterranean fever protein antibody|MEF antibody|Mefv antibody| MEFV_HUMAN antibody|Pyrin antibody|TRIM20 antibody - ID gène
- 4210
- UniProt
- O15553
- Pathways
- Positive Regulation of Endopeptidase Activity
-