EPH Receptor B1 anticorps (N-Term)

N° du produit ABIN3042375

Détail du produit anti-EPH Receptor B1 anticorps

Antigène: EPH Receptor B1 (EPHB1)

Épitope: AA 56-88, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPH Receptor B1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.

Séquence: RTYQVCNVFE PNQNNWLLTT FINRRGAHRI YTE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.
Gene Name: EPH receptor B1
Protein Name: Ephrin type-B receptor 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE) , identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur EPH Receptor B1

Antigène: EPH Receptor B1 (EPHB1)

Autre désignation: EPHB1 (EPHB1 Produits)

Synonymes: anticorps ELK, anticorps EPHT2, anticorps Hek6, anticorps NET, anticorps ephb1-a, anticorps xek, anticorps Xek, anticorps MGC89790, anticorps EPHB1, anticorps CEK6, anticorps EK6, anticorps 9330129L11, anticorps AW488255, anticorps C130099E04Rik, anticorps Cek6, anticorps ENSMUSG00000074119, anticorps Elk, anticorps Elkh, anticorps Net, anticorps Ephb2, anticorps Erk, anticorps elk, anticorps EPH receptor B1, anticorps EPH receptor B1 S homeolog, anticorps ephrin type-B receptor 1, anticorps Eph receptor B1, anticorps EPHB1, anticorps ephb1.S, anticorps ephb1, anticorps LOC100467687, anticorps Ephb1

Sujet: Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

Synonyms: Cek 6 antibody|EK6 antibody|ELK antibody|Elkh antibody|EPH receptor B1 antibody|Eph tyrosine kinase 2 antibody|EPH-like kinase 6 antibody|Ephb1 antibody|EPHB1_HUMAN antibody|Ephrin type B receptor 1 antibody|Ephrin type-B receptor 1 antibody|EPHT2 antibody|HEK 6 antibody|HEK6 antibody|NET antibody|Neuronally-expressed EPH-related tyrosine kinase antibody|soluble EPHB1 variant 1 antibody| Tyrosine protein kinase receptor EPH 2 antibody|Tyrosine-protein kinase receptor EPH-2 antibody

ID gène: 2047

UniProt: P54762

Pathways: Signalisation RTK