FMO1 anticorps (C-Term)

N° du produit ABIN3042396

Détail du produit anti-FMO1 anticorps

Antigène: FMO1 (Flavin Containing Monooxygenase 1 (FMO1))

Épitope: AA 334-363, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMO1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human,Mouse, Rat.

Séquence: AFPFLDESVV KVEDGQASLY KYIFPAHLQK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human,Mouse, Rat.
Gene Name: flavin containing monooxygenase 1
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FMO1

Antigène: FMO1 (Flavin Containing Monooxygenase 1 (FMO1))

Autre désignation: FMO1 (FMO1 Produits)

Synonymes: anticorps RFMO1A, anticorps flavin containing monooxygenase 1, anticorps FMO1, anticorps fmo1, anticorps Fmo1

Sujet: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.

Synonyms: Dimethylaniline monooxygenase [N oxide forming] 1 antibody|Dimethylaniline monooxygenase [N-oxide-forming] 1 antibody|Dimethylaniline oxidase 1 antibody|Fetal hepatic flavin containing monooxygenase 1 antibody|Fetal hepatic flavin-containing monooxygenase 1 antibody| Flavin containing monooxygenase 1 (fetal liver) antibody|Flavin Containing Monooxygenase 1 antibody|FMO 1 antibody|FMO1 antibody| FMO1_HUMAN antibody|OTTHUMP00000033536 antibody|OTTHUMP00000033537 antibody

ID gène: 2326

UniProt: Q01740