FOXA3 anticorps (C-Term)

N° du produit ABIN3042401

Détail du produit anti-FOXA3 anticorps

Antigène: FOXA3 (Forkhead Box A3 (FOXA3))

Épitope: AA 291-324, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FOXA3 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.

Séquence: ELKLDAPYNF NHPFSINNLM SEQTPAPPKL DVGF

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: forkhead box A3
Protein Name: Hepatocyte nuclear factor 3-gamma

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FOXA3

Antigène: FOXA3 (Forkhead Box A3 (FOXA3))

Autre désignation: FOXA3 (FOXA3 Produits)

Synonymes: anticorps FOXA3, anticorps Zffkh1, anticorps fa11c04, anticorps fkd2, anticorps forkhead-2, anticorps wu:fa11c04, anticorps wu:fc37a08, anticorps zf-FKH1, anticorps FKHH3, anticorps HNF3G, anticorps TCF3G, anticorps HNF3-G, anticorps Hnf-3g, anticorps Hnf3g, anticorps Tcf-3g, anticorps Tcf3g, anticorps forkhead box A3, anticorps FOXA3, anticorps foxa3, anticorps Foxa3

Sujet: Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

Synonyms: FKHH3 antibody|Fork head-related protein FKH H3 antibody|forkhead box A3 antibody|Forkhead box protein A3 antibody|Foxa3 antibody| FOXA3_HUMAN antibody|hepatic nuclear factor-3-beta antibody|hepatocyte nuclear factor 3 antibody|hepatocyte nuclear factor 3 gamma antibody|Hepatocyte nuclear factor 3-gamma antibody|HNF-3-gamma antibody|HNF-3G antibody|HNF3B antibody|HNF3G antibody|TCF-3G antibody|TCF3G antibody|Transcription factor 3G antibody

ID gène: 3171

UniProt: P55318

Pathways: Carbohydrate Homeostasis