Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

GRK6 anticorps (C-Term)

GRK6 Reactivité: Humain, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3042435
  • Antigène Voir toutes GRK6 Anticorps
    GRK6 (G Protein-Coupled Receptor Kinase 6 (GRK6))
    Épitope
    • 8
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    AA 382-417, C-Term
    Reactivité
    • 37
    • 23
    • 16
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Humain, Rat
    Hôte
    • 32
    • 5
    Lapin
    Clonalité
    • 34
    • 3
    Polyclonal
    Conjugué
    • 25
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp GRK6 est non-conjugé
    Application
    • 29
    • 17
    • 13
    • 6
    • 3
    • 2
    • 2
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 6(GRK6) detection. Tested with WB in Human,Rat.
    Séquence
    QSPFQQRKKK IKREEVERLV KEVPEEYSER FSPQAR
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 6(GRK6) detection. Tested with WB in Human,Rat.
    Gene Name: G protein-coupled receptor kinase 6
    Protein Name: G protein-coupled receptor kinase 6
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6 (382-417aa QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product GRK6 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Validation #103590 (Western Blotting)
    'Independent Validation' signe
    by
    Institut für Molekulare Zellbiologie, Universitätsklinikum Jena
    No.
    #103590
    Date
    31.01.2019
    Antigène
    GRK6
    Numéro du lot
    0971512Da9609109
    Application validée
    Western Blotting
    Contrôle positif

    HEK293 cells transiently transfected with pcDNA3 vectors containing GRK6 transcript variant 1 (NM_001004106.3), transcript variant 2 (NM_002082.3), transcript variant 3 (NM_001004105.2), or transcript variant 4 (NM_001364164.1)

    Contrôle négative

    HEK293 cells transiently transfected with empty pcDNA3 vector

    Conclusion

    The GRK6 antibody ABIN3042435 is able to detect all four tested GRK6 isoforms, but gives strong background-signals around 55kDa.

    'Independent Validation' signe
    Validation Images
    Protocole
    Anticorps primaire
    ABIN3042435
    Anticorps secondaire
    goat-anti-rabbit Peroxidase-labeled antibody (SeraCare, 5220-0336)
    Full Protocol
    • Grow 7.5x105 HEK293 cells in DMEM-medium (Sigma-Aldrich, D6429)) supplemented with 10% Fetal Bovine serum (Sigma-Aldrich, F7524) and 1% penicillin-streptomycin (Sigma-Aldrich, P0781), at 37°C and 5% CO2 in 2ml on a 6-well-dish (Greiner Bio-One) ON.
    • Transfect cells with 2μg of respective pcDNA3 construct using self-prepared PEI transfection reagent.
    • After 24h lyse the cells in 250μl per well cold RIPA lysis buffer (1 % NP-40, 1mM EDTA, 50mM Tris-HCl pH7.4, 150mM NaCl, 0.25 % Sodium-deoxycholate, PhosSTOP tablet (Roche, 04906845001) and cOmplete tablet (Roche, 04693132001) diluted in RIPA following the manufacturer´s instructions.
    • Denature the cleared lysate of total protein for 5min at 95°C in 50μl of 6x SDS sample buffer and subsequently separate 4μl of each sample on a 10% polyacrylamide gel.
    • Transfer proteins onto nitrocellulose membrane (Biostep 01-14-101) with a Tank Blotting System at 10V ON.
    • Block the membrane with 1x Casein Blocking Buffer (Sigma-Aldrich, B6429) for 1h at RT with gentle shaking.
    • Wash membrane 3x for 10min with TBST.
    • Cut the membrane and incubate fragments separately with primary
      • rabbit anti-GRK6 antibody (ABIN3042435, antibodies-online, lot 0971512Da9609109) diluted 1:1000 in 5% BSA-TBST at 4°C ON.
      • rabbit anti-GRK6 antibody (Cell Signaling Technology, 5878, lot 1) diluted 1:1000 in 5% BSA-TBST at 4°C ON.
      • rabbit anti-Vinculin antibody (Biozol, BZL03106, lot 0401) diluted 1:1000 in 5% BSA-TBST at 4°C ON.
    • Wash membrane 3x for 10min with TBST.
    • Incubate membrane with secondary goat-anti-rabbit Peroxidase-labeled antibody (SeraCare, 5220-0336) diluted 1:10000 in 1x Casein Blocking Buffer) for 1h at RT with gentle shaking.
    • Wash membrane 3x for 10min with TBST.
    • Reveal protein bands using Western Lightning Plus ECL reagent (Perkin Elmer, NEL103001EA, Luminol reagent Lot 275-17431, Oxidizing reagent, lot 265-17431) on a LAS-4000 Luminescence Imager (Fujifilm), exposure for 15 and 90 seconds.
    Notes

    If the detection of the smallest isoform (GRK6-4, transcript variant 4, NM_001364164.1) is required, ABIN3042435 is a good choice, as this isoform is not detected by the alternative GRK6 antibody tested in parallel. Nevertheless, the strong background signal around 55kDa produced by ABIN3042435 diminishes its usefulness.

  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Reichel, Weitzel, Klement, Hoffmann, Drube: "Suitability of GRK Antibodies for Individual Detection and Quantification of GRK Isoforms in Western Blots." dans: International journal of molecular sciences, Vol. 23, Issue 3, (2022) (PubMed).

  • Antigène
    GRK6 (G Protein-Coupled Receptor Kinase 6 (GRK6))
    Autre désignation
    GRK6 (GRK6 Produits)
    Synonymes
    anticorps MGC83187, anticorps GRK6, anticorps GPRK6, anticorps Gprk6, anticorps G protein-coupled receptor kinase 6, anticorps G protein-coupled receptor kinase 6 S homeolog, anticorps GRK6, anticorps grk6.S, anticorps grk6, anticorps Grk6
    Sujet
    G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses to morphine.

    Synonyms: FLJ32135 antibody|G protein coupled receptor kinase 6 antibody|G protein coupled receptor kinase GRK6 antibody|G protein-coupled receptor kinase 6 antibody|G protein-coupled receptor kinase GRK6 antibody|Gprk6 antibody|Grk6 antibody|GRK6_HUMAN antibody
    ID gène
    2870
    UniProt
    P43250
    Pathways
    Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Negative Regulation of Transporter Activity
Vous êtes ici:
Support technique