HHEX anticorps (Middle Region)
-
- Antigène Voir toutes HHEX Anticorps
- HHEX (Hematopoietically Expressed Homeobox (HHEX))
-
Épitope
- AA 146-180, Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HHEX est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human,Mouse, Rat.
- Séquence
- NDQTIELEKK FETQKYLSPP ERKRLAKMLQ LSERQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human,Mouse, Rat.
Gene Name: hematopoietically expressed homeobox
Protein Name: Hematopoietically-expressed homeobox protein Hhex - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product HHEX Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- HHEX (Hematopoietically Expressed Homeobox (HHEX))
- Autre désignation
- HHEX (HHEX Produits)
- Synonymes
- anticorps hhex, anticorps Hex, anticorps prh, anticorps XHex, anticorps hmph, anticorps prhx, anticorps tHex, anticorps hox11l-pen, anticorps HHEX, anticorps hex, anticorps hhex-A, anticorps HEX, anticorps HMPH, anticorps HOX11L-PEN, anticorps PRH, anticorps PRHX, anticorps Hex1, anticorps Hhex-rs2, anticorps Prh, anticorps Prhx, anticorps PROBOX, anticorps Homeobox protein PRH, anticorps hematopoietically expressed homeobox, anticorps hematopoietically expressed homeobox L homeolog, anticorps Bm1_31285, anticorps hhex, anticorps HHEX, anticorps Hex1, anticorps hhex.L, anticorps Hhex
- Sujet
-
Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.'s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.
Synonyms: Hematopoietically expressed homeobox antibody|Hematopoietically-expressed homeobox protein HHEX antibody|HEX antibody|HHEX antibody| HHEX_HUMAN antibody|HMPH antibody|Homeobox hematopoietically expressed antibody|Homeobox protein HEX antibody|Homeobox protein PRH antibody|HOX11L PEN antibody|PRH antibody|PRHX antibody|Proline rich homeodomain containing transcription factor antibody| OTTHUMP00000206478 antibody|OTTHUMP00000206479 antibody|OTTHUMP00000206480 antibody|OTTHUMP00000206482 antibody|OTTHUMP00000207360 antibody|USURPIN antibody|Usurpin beta antibody - ID gène
- 3087
- UniProt
- Q03014
-