HMGB3 anticorps (N-Term)

N° du produit ABIN3042447

Détail du produit anti-HMGB3 anticorps

Antigène: HMGB3 (High Mobility Group Box 3 (HMGB3))

Épitope: AA 62-95, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGB3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: high mobility group box 3
Protein Name: High mobility group protein B3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HMGB3

Antigène: HMGB3 (High Mobility Group Box 3 (HMGB3))

Autre désignation: HMGB3 (HMGB3 Produits)

Synonymes: anticorps HMG-2a, anticorps HMG-4, anticorps HMG2A, anticorps HMG4, anticorps Hmg2a, anticorps Hmg4, anticorps RGD1564407, anticorps hmgb3, anticorps MGC54022, anticorps Xhmgb3, anticorps MGC88931, anticorps fa19b06, anticorps fj43d02, anticorps wu:fa19b06, anticorps wu:fj43d02, anticorps zgc:112073, anticorps HMGB3, anticorps NFD03, anticorps NFD3, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR, anticorps high mobility group B3, anticorps HMG-1, anticorps HMG2a, anticorps HMGB1, anticorps high mobility group box 3, anticorps high mobility group box 3b, anticorps high mobility group box 3 S homeolog, anticorps high mobility group protein, anticorps high mobility group B3, anticorps High mobility group protein B3, anticorps HMGB3, anticorps Hmgb3, anticorps hmgb3, anticorps hmgb3b, anticorps hmgb3.S

Sujet: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

Synonyms: chromosomal protein, Nonhistone, HMG4 antibody|High mobility group (nonhistone chromosomal) protein 4 antibody|High mobility group box 3 antibody|High mobility group protein 2a antibody|High mobility group protein 4 antibody|High mobility group protein B3 antibody| High mobility group protein HMG4 antibody|HMG 4 antibody|HMG-2a antibody|HMG-4 antibody|HMG2A antibody|HMGB 3 antibody|HMGB3 antibody| HMGB3_HUMAN antibody|MGC90319 antibody|Non histone chromosomal protein antibody|Nonhistone chromosomal protein HMG4 antibody

ID gène: 3149

UniProt: O15347