IRF2 anticorps (C-Term)
-
- Antigène Voir toutes IRF2 Anticorps
- IRF2 (Interferon Regulatory Factor 2 (IRF2))
-
Épitope
- AA 317-348, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IRF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human,Rat.
- Séquence
- MTPASSSSRP DRETRASVIK KTSDITQARV KS
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human,Rat.
Gene Name: interferon regulatory factor 2
Protein Name: Interferon regulatory factor 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS), different from the related mouse sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product IRF2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- IRF2 (Interferon Regulatory Factor 2 (IRF2))
- Autre désignation
- IRF2 (IRF2 Produits)
- Synonymes
- anticorps IRF-2, anticorps 9830146E22Rik, anticorps AI646973, anticorps Irf-2, anticorps irf2b, anticorps zgc:103451, anticorps irf-2, anticorps wu:fc74h04, anticorps zgc:76951, anticorps interferon regulatory factor 2, anticorps interferon regulatory factor 2 L homeolog, anticorps interferon regulatory factor 2a, anticorps IRF2, anticorps Irf2, anticorps irf2, anticorps irf2.L, anticorps irf2a
- Sujet
-
IRF2 (interferon regulatory factor 2) is a member of the interferon regulatory transcription factor (IRF) family. The IRF2 gene is mapped on 4q35.1. When the IRF2 gene was overexpressed in NIH 3T3 cells, the cells became transformed and displayed enhanced tumorigenicity in nude mice. One IRF binding site was found within the IRF2 promoter, and expression of the IRF2 gene was affected by both transient and stable IRF1 expression. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. Irf2 was required to prevent NK-cell apoptosis and keep immature NK cells alive, thus promoting NK-cell maturation and their supply to peripheral blood.
Synonyms: DKFZp686F0244 antibody|Interferon regulatory factor 2 antibody|IRF 2 antibody|IRF-2 antibody|IRF2 antibody|IRF2_HUMAN antibody - ID gène
- 3660
- UniProt
- P14316
-