Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

KCNA3 anticorps (C-Term)

KCNA3 Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3042473
  • Antigène Voir toutes KCNA3 Anticorps
    KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))
    Épitope
    • 17
    • 15
    • 8
    • 8
    • 7
    • 7
    • 5
    • 4
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 513-544, C-Term
    Reactivité
    • 77
    • 24
    • 23
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 75
    • 3
    • 1
    Lapin
    Clonalité
    • 76
    • 3
    Polyclonal
    Conjugué
    • 32
    • 5
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp KCNA3 est non-conjugé
    Application
    • 53
    • 32
    • 26
    • 26
    • 16
    • 16
    • 11
    • 7
    • 5
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3(KCNA3) detection. Tested with WB in Human,Mouse,Rat.
    Séquence
    EELRKARSNS TLSKSEYMVI EEGGMNHSAF PQ
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3(KCNA3) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: potassium channel, voltage gated shaker related subfamily A, member 3
    Protein Name: Potassium voltage-gated channel subfamily A member 3
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product KCNA3 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))
    Autre désignation
    KCNA3 (KCNA3 Produits)
    Synonymes
    anticorps Kv1.3-glyb, anticorps kv1.3, anticorps Kv1.3B, anticorps kcna3b-a, anticorps HGK5, anticorps HLK3, anticorps HPCN3, anticorps HUKIII, anticorps KV1.3, anticorps MK3, anticorps PCN3, anticorps Kca1-3, anticorps Kv1.3, anticorps Mk-3, anticorps cKv1.1, anticorps potassium voltage-gated channel subfamily A member 3, anticorps potassium channel, voltage gated shaker related subfamily A, member 3 S homeolog, anticorps potassium voltage-gated channel, shaker-related subfamily, member 3, anticorps KCNA3, anticorps kcna3.S, anticorps Kcna3
    Sujet
    Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.

    Synonyms: HGK 5 antibody|HGK5 antibody|HLK 3 antibody|HLK3 antibody|HPCN 3 antibody|HPCN3 antibody|HuKIII antibody|KCNA 3 antibody|Kcna3 antibody|KCNA3_HUMAN antibody|KV1.3 antibody|MK 3 antibody|MK3 antibody|OTTHUMP00000032397 antibody|PCN 3 antibody|PCN3 antibody| Potassium channel 3 antibody|Potassium voltage gated channel shaker related subfamily member 3 antibody|Potassium voltage gated channel subfamily A member 3 antibody|Potassium voltage-gated channel subfamily A member 3 antibody|Type n potassium channel antibody| Voltage gated potassium channel protein Kv1.3 antibody|Voltage gated potassium channel subunit Kv1.3 antibody|Voltage-gated K(+) channel HuKIII antibody|Voltage-gated potassium channel subunit Kv1.3 antibody
    ID gène
    3738
    UniProt
    P22001
Vous êtes ici:
Support technique