IGFBP5 anticorps (N-Term)

N° du produit ABIN3042733

Détail du produit anti-IGFBP5 anticorps

Antigène: IGFBP5 (Insulin-Like Growth Factor Binding Protein 5 (IGFBP5))

Épitope: AA 76-114, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFBP5 est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.

Séquence: QGLRCLPRQD EEKPLHALLH GRGVCLNEKS YREQVKIER

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.
Gene Name: insulin-like growth factor binding protein 5
Protein Name: Insulin-like growth factor-binding protein 5

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-IGFBP5 (ABIN3042733)

Wan, Ma, Mei, Shan: "The effects of HIF-1alpha on gene expression profiles of NCI-H446 human small cell lung cancer cells." dans: Journal of experimental & clinical cancer research : CR, Vol. 28, pp. 150, (2010) (PubMed).

Hou, Zhang, Liu, Meng, Qiao: "Expressions of IGFBP-5, cFLIP in cervical intraepithelial neoplasia, cervical carcinoma and their clinical significances: a molecular pathology." dans: Journal of experimental & clinical cancer research : CR, Vol. 28, pp. 70, (2009) (PubMed).

Détails sur IGFBP5

Antigène: IGFBP5 (Insulin-Like Growth Factor Binding Protein 5 (IGFBP5))

Autre désignation: IGFBP5 (IGFBP5 Produits)

Synonymes: anticorps IBP5, anticorps AI256729, anticorps AW208790, anticorps IGFBP-5, anticorps IGFBP-5P, anticorps IGF-BP5, anticorps igfbp5, anticorps ibp5, anticorps IBP-5, anticorps xIGFBP-5, anticorps IGFBP5, anticorps igfbp5b, anticorps zgc:165472, anticorps insulin like growth factor binding protein 5, anticorps insulin-like growth factor binding protein 5, anticorps insulin like growth factor binding protein 5 L homeolog, anticorps insulin-like growth factor binding protein 5b, anticorps insulin-like growth factor-binding protein 5, anticorps insulin-like growth factor binding protein 5a, anticorps IGFBP5, anticorps Igfbp5, anticorps igfbp5.L, anticorps igfbp5b, anticorps igfbp5, anticorps LOC100194500, anticorps igfbp5a

Sujet: Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in 2 human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved to a biologically inactive 21 kDa fragment (1, 2).

Synonyms: IBP 5 antibody|IBP-5 antibody|IBP5 antibody|IBP5_HUMAN antibody|IGF binding protein 5 antibody|IGF BP5 antibody|IGF-binding protein 5 antibody|IGFBP 5 antibody|IGFBP-5 antibody|IGFBP5 antibody|Insulin like growth factor binding protein 5 antibody|Insulin-like growth factor-binding protein 5 antibody

ID gène: 3488

UniProt: P24593

Pathways: Signalisation WNT, Carbohydrate Homeostasis, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process, Autophagy, Smooth Muscle Cell Migration, Growth Factor Binding