CPT1B anticorps (N-Term)
-
- Antigène Voir toutes CPT1B Anticorps
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
-
Épitope
- AA 197-226, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPT1B est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- DDEEYYRMEL LAKEFQDKTA PRLQKYLVLK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: carnitine palmitoyltransferase 1B (muscle)
Protein Name: Carnitine O-palmitoyltransferase 1, muscle isoform - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CPT1B Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
- Autre désignation
- CPT1B (CPT1B Produits)
- Synonymes
- anticorps CPT1-M, anticorps CPT1M, anticorps CPTI, anticorps CPTI-M, anticorps M-CPT1, anticorps MCCPT1, anticorps MCPT1, anticorps CPT-IB, anticorps M-CPTI, anticorps CPT1, anticorps CPTIB, anticorps cpt1al, anticorps zgc:103709, anticorps CPT1B, anticorps MGC147544, anticorps Cpt1, anticorps Cpt1-m, anticorps Cpti, anticorps Cpti-m, anticorps M-cpti, anticorps carnitine palmitoyltransferase 1B, anticorps carnitine palmitoyltransferase 1B (muscle), anticorps carnitine palmitoyltransferase 1B L homeolog, anticorps carnitine palmitoyltransferase 1b, muscle, anticorps CPT1B, anticorps Cpt1b, anticorps cpt1b, anticorps cpt1b.L
- Sujet
-
CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
Synonyms: muscle isoform antibody|Carnitine O palmitoyltransferase I mitochondrial muscle isoform antibody|Carnitine O palmitoyltransferase I muscle isoform antibody|Carnitine O-palmitoyl transferase 1, muscle isoform antibody|Carnitine O-palmitoyltransferase I antibody| Carnitine palmitoyltransferase 1A (muscle) antibody|Carnitine palmitoyltransferase 1B (muscle) antibody|Carnitine palmitoyltransferase 1B antibody|Carnitine palmitoyltransferase I like protein antibody|Carnitine palmitoyltransferase I muscle antibody|Carnitine palmitoyltransferase I-like protein antibody|CPT 1B antibody|CPT I antibody|CPT1 M antibody|CPT1 muscle antibody|CPT1-M antibody|Cpt1b antibody|CPT1B_HUMAN antibody|CPT1M antibody|CPTI antibody|CPTI M antibody|CPTI muscle antibody|CPTI-M antibody|CPTIM antibody| FLJ55729 antibody|FLJ58750 antibody|KIAA1670 antibody|M CPT1 antibody|M-CPT1 antibody| MCCPT1 antibody|MCPT1 antibody|muscle isoform antibody - ID gène
- 1375
- UniProt
- Q92523
- Pathways
- AMPK Signaling, Monocarboxylic Acid Catabolic Process
-