CRY2 anticorps (N-Term)

N° du produit ABIN3042760

Détail du produit anti-CRY2 anticorps

Antigène: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Épitope: AA 171-200, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRY2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: RFQAIISRME LPKKPVGLVT SQQMESCRAE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cryptochrome circadian clock 2
Protein Name: Cryptochrome-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE), different from the related mouse and rat sequences by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CRY2

Antigène: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Autre désignation: CRY2 (CRY2 Produits)

Synonymes: anticorps Cry2, anticorps Cry, anticorps GB10211, anticorps CRY2, anticorps AT-PHH1, anticorps ATCRY2, anticorps CRYPTOCHROME 2 APOPROTEIN, anticorps F19P19.14, anticorps F19P19_14, anticorps FHA, anticorps PHH1, anticorps cryptochrome 2, anticorps HCRY2, anticorps PHLL2, anticorps AV006279, anticorps D130054K12Rik, anticorps gCry2, anticorps cryptochrome circadian regulator 2, anticorps cryptochrome 2, anticorps cryptochrome Cry2, anticorps cryptochrome circadian clock 2, anticorps cryptochrome 2 (photolyase-like), anticorps CRY2, anticorps Cry2, anticorps cry2, anticorps LOC100502533

Sujet: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: cry2 antibody|CRY2_HUMAN antibody|cryptochrome 2 (photolyase like) antibody|Cryptochrome 2 antibody|Cryptochrome-2 antibody|FLJ10332 antibody|growth inhibiting protein 37 antibody|HCRY2 antibody|KIAA0658 antibody|PHLL2 antibody|Photolyase like antibody

ID gène: 1408

Pathways: Response to Water Deprivation, Protein targeting to Nucleus