CSNK1A1 anticorps (N-Term)

N° du produit ABIN3042767

Détail du produit anti-CSNK1A1 anticorps

Antigène: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Épitope: AA 30-68, N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSNK1A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DIYLAINITN GEEVAVKLES QKARHPQLLY ESKLYKILQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: casein kinase 1, alpha 1
Protein Name: Casein kinase I isoform alpha

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CSNK1A1

Antigène: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Autre désignation: CSNK1A1 (CSNK1A1 Produits)

Synonymes: anticorps CK1, anticorps CK1a, anticorps CKIa, anticorps HLCDGP1, anticorps PRO2975, anticorps 2610208K14Rik, anticorps 4632404G05Rik, anticorps 5430427P18Rik, anticorps Csnk1a, anticorps CHUNP6894, anticorps ck1alpha, anticorps wu:fb65a02, anticorps wu:fi30h04, anticorps wu:fj19c11, anticorps zgc:92158, anticorps KER1, anticorps ck1, anticorps CKIALPHA, anticorps CK-II, anticorps CSNK2A1, anticorps CG2028, anticorps CK I, anticorps CK1alpha, anticorps CKI, anticorps CKI alpha, anticorps CKIalpha, anticorps CkIa, anticorps Dmel\\CG2028, anticorps PKA-C, anticorps anon-WO03040301.93, anticorps anon-WO03040301.95, anticorps ck1a, anticorps dmCK1, anticorps dmckI, anticorps l(1)G0492, anticorps casein kinase 1 alpha 1, anticorps casein kinase 1, alpha 1, anticorps keratin 1, anticorps casein kinase 1 alpha 1 L homeolog, anticorps casein kinase 2 alpha 1, anticorps Casein kinase Ialpha, anticorps CSNK1A1, anticorps Csnk1a1, anticorps csnk1a1, anticorps KRT1, anticorps csnk1a1.L, anticorps CSNK2A1, anticorps CkIalpha

Sujet: Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

Synonyms: Casein kinase 1 alpha 1 antibody|Casein kinase I isoform alpha antibody|CK1 antibody|CK1A antibody|CKI alpha antibody|CKI-alpha antibody|CKIa antibody|Clock regulator kinase antibody|Csnk1a1 antibody|Down regulated in lung cancer antibody|HLCDGP1 antibody| KC1A_HUMAN antibody|PRO2975 antibody

ID gène: 1452

UniProt: P48729

Pathways: Signalisation WNT, Signalisation Hedgehog