Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Kv1.4 anticorps (C-Term)

KCNA4 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043264
  • Antigène Voir toutes Kv1.4 (KCNA4) Anticorps
    Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))
    Épitope
    • 15
    • 14
    • 8
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 609-647, C-Term
    Reactivité
    • 39
    • 8
    • 6
    • 1
    • 1
    • 1
    Humain
    Hôte
    • 40
    • 2
    Lapin
    Clonalité
    • 41
    • 1
    Polyclonal
    Conjugué
    • 18
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp Kv1.4 est non-conjugé
    Application
    • 27
    • 19
    • 13
    • 13
    • 4
    • 4
    • 4
    • 3
    • 3
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4(KCNA4) detection. Tested with WB, IHC-P in Human.
    Séquence
    SEYLEMEEGV KESLCAKEEK CQGKGDDSET DKNNCSNAK
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4(KCNA4) detection. Tested with WB, IHC-P in Human.
    Gene Name: potassium voltage-gated channel, shaker-related subfamily, member 4
    Protein Name: Potassium voltage-gated channel subfamily A member 4
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
    Isotype
    IgG
    Top Product
    Discover our top product KCNA4 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))
    Autre désignation
    KCNA4 (KCNA4 Produits)
    Synonymes
    anticorps KV1.4, anticorps KCNA4, anticorps Kv1.4, anticorps DKFZp459N0126, anticorps KCHAN, anticorps Kv4, anticorps RHK1, anticorps RK3, anticorps HBK4, anticorps HK1, anticorps HPCN2, anticorps HUKII, anticorps KCNA4L, anticorps KCNA8, anticorps PCN2, anticorps potassium voltage-gated channel subfamily A member 4, anticorps potassium voltage-gated channel subfamily A member 4 S homeolog, anticorps potassium voltage-gated channel, shaker-related subfamily, member 4, anticorps KCNA4, anticorps LOC100622932, anticorps kcna4.S, anticorps Kcna4
    Sujet
    Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.

    Synonyms: Voltage gated K+ channel HuKII antibody|cardiac potassium channel antibody|fetal skeletal muscle potassium channel antibody|HBK 4 antibody|HBK4 antibody|HK 1 antibody|HK1 antibody|HPCN 2 antibody|HPCN2 antibody|HUK II antibody|HUKII antibody|KCNA 4 antibody|KCNA 8 antibody|KCNA4 antibody|KCNA4_HUMAN antibody|KCNA4L antibody|KCNA8 antibody|kv1.4 antibody|PCN 2 antibody|PCN2 antibody|potassium channel 2 antibody|potassium channel KCNA4 antibody|potassium channel protein antibody|Potassium voltage gated channel shaker related subfamily member 4 antibody|Potassium voltage gated channel subfamily A member 4 antibody|potassium voltage-gated channel shaker-related subfamily member 4-like antibody|Potassium voltage-gated channel subfamily A member 4 antibody|rapidly inactivating potassium channel antibody|Shaker related potassium channel Kv1.4 antibody|shaker-related potassium channel Kv1.4 antibody|type A potassium channel antibody|Voltage gated potassium channel HBK4 antibody|Voltage gated potassium channel HK1 antibody|Voltage gated potassium channel subunit Kv1.4 antibody|Voltage-gated K(+) channel HuKII antibody|voltage-gated potassium channel antibody|Voltage-gated potassium channel HBK4 antibody|Voltage-gated potassium channel HK1 antibody|voltage-gated potassium channel protein Kv1.4 antibody| Voltage-gated potassium channel subunit Kv1.4 antibody
    ID gène
    3739
    UniProt
    P22459
Vous êtes ici:
Support technique