KERA anticorps (C-Term)
-
- Antigène Voir toutes KERA Anticorps
- KERA (Keratocan (KERA))
-
Épitope
- AA 77-109, C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KERA est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human,Mouse.
- Séquence
- YLQNNLIETI PEKPFENATQ LRWINLNKNK ITN
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human,Mouse.
Gene Name: keratocan
Protein Name: Keratocan - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product KERA Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- KERA (Keratocan (KERA))
- Autre désignation
- KERA (KERA Produits)
- Synonymes
- anticorps KERA, anticorps si:dkeyp-38g8.3, anticorps zgc:136259, anticorps CNA2, anticorps SLRR2B, anticorps keratocan, anticorps KERA, anticorps kera, anticorps Kera
- Sujet
-
Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.
Synonyms: CNA2 antibody|KERA antibody|KERA_HUMAN antibody|Keratan sulfate proteoglycan keratocan antibody|Keratocan antibody|KTN antibody|SLRR2B antibody - ID gène
- 11081
- UniProt
- O60938
- Pathways
- Glycosaminoglycan Metabolic Process
-