Nibrin anticorps (C-Term)

N° du produit ABIN3043282

Détail du produit anti-Nibrin anticorps

Antigène: Nibrin (NBN)

Épitope: AA 714-745, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nibrin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: RKNTELEEWL RQEMEVQNQH AKEESLADDL FR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: nibrin
Protein Name: Nibrin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Nibrin

Antigène: Nibrin (NBN)

Autre désignation: NBN (NBN Produits)

Synonymes: anticorps NBN, anticorps AT-V1, anticorps AT-V2, anticorps ATV, anticorps NBS, anticorps NBS1, anticorps P95, anticorps Nbs1, anticorps im:6911679, anticorps zgc:194152, anticorps nibrin, anticorps NBN, anticorps nbn, anticorps Nbn

Sujet: P95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50(N/M/R, more commonly referred to asMRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).

Synonyms: AT V1 antibody|AT V2 antibody|ATV antibody|ATV antibody|Cell cycle regulatory protein p95 antibody|FLJ10155 antibody|MGC87362 antibody|NBN antibody|NBN_HUMAN antibody|NBS 1 antibody|NBS antibody|NBS antibody|NBS1 antibody|Nibrin antibody|Nibrin antibody| Nijmegen breakage syndrome 1 (nibrin) antibody|Nijmegen breakage syndrome antibody|Nijmegen breakage syndrome protein 1 antibody|p95 antibody|p95 antibody|p95 protein of the MRE11/RAD50 complex antibody

ID gène: 4683

UniProt: O60934

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response