c-Rel anticorps (Middle Region)

N° du produit ABIN3043314

Détail du produit anti-c-Rel anticorps

Antigène: c-Rel (REL proto-oncogene (c-Rel))

Épitope: AA 268-306, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp c-Rel est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DQEVSESMDF RYLPDEKDAY GNKSKKQKTT LIFQKLLQD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: v-rel avian reticuloendotheliosis viral oncogene homolog
Protein Name: Proto-oncogene c-Rel

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur c-Rel

Antigène: c-Rel (REL proto-oncogene (c-Rel))

Autre désignation: REL (c-Rel Produits)

Synonymes: anticorps C-Rel, anticorps c-Rel, anticorps NFkB, anticorps c-rel, anticorps zgc:100833, anticorps Xrel2, anticorps Xrel3, anticorps rel, anticorps rel-A, anticorps rel2, anticorps rel3, anticorps v-rel, anticorps xrel, anticorps REL proto-oncogene, NF-kB subunit, anticorps reticuloendotheliosis oncogene, anticorps RELA proto-oncogene, NF-kB subunit, anticorps v-rel avian reticuloendotheliosis viral oncogene homolog, anticorps v-rel avian reticuloendotheliosis viral oncogene homolog L homeolog, anticorps ribonuclease A family member 2 pseudogene, anticorps REL, anticorps Rel, anticorps Rela, anticorps rel, anticorps rel.L, anticorps ECRP

Sujet: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-κB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

Synonyms: Avian reticuloendotheliosis antibody|C REL antibody|C Rel protein antibody|c Rel proto oncogene protein antibody|Oncogene REL antibody|Oncogene REL avian reticuloendotheliosis antibody|Proto-oncogene c-Rel antibody|REL antibody|REL_HUMAN antibody|v rel avian reticuloendotheliosis viral oncogene homolog antibody|v rel reticuloendotheliosis viral oncogene homolog antibody|V rel reticuloendotheliosis viral oncogene homolog (avian) antibody

ID gène: 19696

UniProt: P15307