RUNX1 anticorps (Middle Region)

N° du produit ABIN3043318

Détail du produit anti-RUNX1 anticorps

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Épitope: AA 200-233, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUNX1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Runt-related transcription factor 1(RUNX1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ELEQLRRTAM RVSPHHPAPT PNPRASLNHS TAFN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Runt-related transcription factor 1(RUNX1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: runt-related transcription factor 1
Protein Name: Runt-related transcription factor 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for RUNX1 is approximately 0.25 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-RUNX1 (ABIN3043318)

Du, Li, Zhong, Fan, Qiao, He, Fu, Wang, Ye: "Brain death induces the alteration of liver protein expression profiles in rabbits." dans: International journal of molecular medicine, Vol. 34, Issue 2, pp. 578-84, (2014) (PubMed).

Détails sur RUNX1

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Autre désignation: RUNX1 (RUNX1 Produits)

Synonymes: anticorps RUNX1, anticorps runx1, anticorps AI462102, anticorps AML1, anticorps Cbfa2, anticorps Pebp2a2, anticorps Pebpa2b, anticorps AML1-EVI-1, anticorps AMLCR1, anticorps CBFA2, anticorps EVI-1, anticorps PEBP2aB, anticorps runxa, anticorps Runx-1, anticorps XAML, anticorps Xaml1, anticorps aml, anticorps aml-1, anticorps aml1, anticorps aml1-evi-1, anticorps amlcr1, anticorps cbfa2, anticorps evi-1, anticorps pebp2ab, anticorps Aml1, anticorps uncharacterized LOC473981, anticorps runt-related transcription factor, anticorps runt related transcription factor 1, anticorps runt-related transcription factor 1, anticorps runt related transcription factor 1 L homeolog, anticorps LOC473981, anticorps runt, anticorps Runx1, anticorps RUNX1, anticorps runx1, anticorps runx1.L

Sujet: Runt-related transcription factor 1 (RUNX1), also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBFα). RUNX1 is mapped to 21q22.12. RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFβ which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the RUNX1 gene are associated with several types of leukemia including M2 AML. Mutations in RUNX1 are implicated in cases of breast cancer.

Synonyms: Acute myeloid leukemia 1 antibody|Acute myeloid leukemia 1 protein antibody|alpha subunit antibody|alpha subunit core binding factor antibody|AML 1 antibody|AML1 antibody|AML1 EVI 1 antibody|AML1 EVI 1 fusion protein antibody|Aml1 oncogene antibody|AMLCR 1 antibody|AMLCR1 antibody|CBF alpha 2 antibody|CBF-alpha-2 antibody|CBFA 2 antibody|CBFA2 antibody|Core binding factor alpha 2 subunit antibody|Core binding factor runt domain alpha subunit 2 antibody|Core-binding factor subunit alpha-2 antibody|EVI 1 antibody|EVI1 antibody|Oncogene AML 1 antibody|Oncogene AML-1 antibody|OTTHUMP00000108696 antibody|OTTHUMP00000108697 antibody|OTTHUMP00000108699 antibodyOTTHUMP00000108700 antibody|OTTHUMP00000108702 antibody|PEA2 alpha B antibody|PEA2-alpha B antibody|PEBP2 alpha B antibody|PEBP2-alpha B antibody|PEBP2A2 antibody|PEBP2aB antibody|Polyomavirus enhancer binding protein 2 alpha B subunit antibody|Polyomavirus enhancer-binding protein 2 alpha B subunit antibody|Run1 antibody|Runt related transcription factor 1 antibody|Runt-related transcription factor 1 antibody|RUNX 1 antibody|Runx1 antibody|RUNX1_HUMAN antibody|SL3 3 enhancer factor 1 alpha B subunit antibody|SL3-3 enhancer factor 1 alpha B subunit antibody|SL3/AKV core binding factor alpha B subunit antibody|SL3/AKV core-binding factor alpha B subunit antibody

ID gène: 861

UniProt: Q01196