SLC10A1 anticorps (C-Term)
-
- Antigène Voir toutes SLC10A1 Anticorps
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
-
Épitope
- AA 296-336, C-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC10A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter(SLC10A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- EGLLFIIIFR CYLKIKPQKD QTKITYKAAA TEDATPAALE K
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter(SLC10A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Protein Name: Sodium/bile acid cotransporter - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SLC10A1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
- Autre désignation
- SLC10A1 (SLC10A1 Produits)
- Synonymes
- anticorps Ntcp, anticorps NTCP, anticorps Ntcp1, anticorps SBACT, anticorps solute carrier family 10 (sodium/bile acid cotransporter family), member 1, anticorps solute carrier family 10 member 1, anticorps Slc10a1, anticorps SLC10A1
- Sujet
-
Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.
Synonyms: Cell growth-inhibiting gene 29 protein antibody|Growth inhibiting protein 29 antibody|Na / bile acid cotransporter antibody|Na / taurocholate transport protein antibody|Na(+)/bile acid cotransporter antibody|Na(+)/taurocholate transport protein antibody|Na/taurocholate cotransporting polypeptide antibody|NTCP antibody|NTCP_HUMAN antibody|NTCP1 antibody| SLC10A1 antibody|Sodium/bile acid cotransporter antibody|Sodium/taurocholate cotransporter antibody|Sodium/taurocholate cotransporting polypeptide antibody|Solute carrier family 10 (sodium/bile acid cotransporter family) member 1 antibody|Solute carrier family 10 member 1 antibody - ID gène
- 20493
- UniProt
- O08705
-