SOX5 anticorps (C-Term)

N° du produit ABIN3043348

Détail du produit anti-SOX5 anticorps

Antigène: SOX5 (SRY (Sex Determining Region Y)-Box 5 (SOX5))

Épitope: AA 495-528, C-Term

Reactivité: Humain, Rat, Souris, Porc

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOX5 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human,Mouse,Rat,Pig.

Séquence: EKEKTTLESL TQQLAVKQNE EGKFSHAMMD FNLS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human,Mouse,Rat,Pig.
Gene Name: SRY (sex determining region Y)-box 5
Protein Name: Transcription factor SOX-5

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, Pig
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SOX5

Antigène: SOX5 (SRY (Sex Determining Region Y)-Box 5 (SOX5))

Autre désignation: SOX5 (SOX5 Produits)

Synonymes: anticorps L-SOX5, anticorps XSox-5, anticorps l-sox5, anticorps A730017D01Rik, anticorps AI528773, anticorps Sox5l1, anticorps xSox5, anticorps id:ibd5067, anticorps sb:eu456, anticorps si:dkey-215a8.1, anticorps SRY-box 5, anticorps SRY (sex determining region Y)-box 5, anticorps SRY box 5, anticorps SRY-box 5 S homeolog, anticorps SOX5, anticorps sox5, anticorps Sox5, anticorps sox5.S

Sujet: Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Synonyms: L SOX5 antibody|MGC35153 antibody|Sex determining region Y box 5 antibody|SOX 5 antibody| SOX 5 protein antibody|Sox5 antibody|SOX5 protein antibody|SOX5_HUMAN antibody|SRY (sex determining region Y) box 5 antibody|SRY box 5 antibody|Transcription factor SOX 5 antibody|Transcription factor SOX-5 antibody|Transcription factor SOX5 antibody

ID gène: 6660

UniProt: P35711