RAB18 anticorps (C-Term)

N° du produit ABIN3043365

Détail du produit anti-RAB18 anticorps

Antigène: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Épitope: AA 156-192, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB18 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.

Séquence: DGVQCAFEEL VEKIIQTPGL WESENQNKGV KLSHREE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.
Gene Name: RAB18, member RAS oncogene family
Protein Name: Ras-related protein Rab-18

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur RAB18

Antigène: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Autre désignation: RAB18 (RAB18 Produits)

Synonymes: anticorps RAB18LI1, anticorps WARBM3, anticorps AA959686, anticorps RAB18, anticorps rab18li1, anticorps LOC100219058, anticorps rab18, anticorps zgc:92523, anticorps fc62e07, anticorps wu:fc62e07, anticorps zgc:77145, anticorps RAB18, member RAS oncogene family, anticorps ras-related protein Rab-18-B, anticorps ras-related protein Rab-18-like, anticorps Ras-related protein Rab-18, anticorps RAB18, member RAS oncogene family S homeolog, anticorps RAB18B, member RAS oncogene family, anticorps RAB18A, member RAS oncogene family, anticorps RAB18, anticorps Rab18, anticorps rab18, anticorps LOC100219058, anticorps rab-18, anticorps rab18.S, anticorps rab18b, anticorps rab18a

Sujet: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

Synonyms: AA959686 antibody|RAB18 antibody|RAB18 small GTPase antibody|RAB18, member RAS oncogene family antibody|RAB18_HUMAN antibody|RAB18LI1 antibody|Ras related protein Rab 18 antibody|Ras-asssociated protein RAB18 antibody|Ras-related protein Rab-18 antibody|RP11-148B2.1 antibody|WARBM3 antibody

ID gène: 22931

Pathways: SARS-CoV-2 Protein Interactome