LGALS8 anticorps (C-Term)
-
- Antigène Voir toutes LGALS8 Anticorps
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
-
Épitope
- AA 286-317, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LGALS8 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.
- Séquence
- HSLEYKHRFK ELSSIDTLEI NGDIHLLEVR SW
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.
Gene Name: lectin, galactoside-binding, soluble, 8
Protein Name: Galectin-8 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product LGALS8 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
- Autre désignation
- LGALS8 (LGALS8 Produits)
- Synonymes
- anticorps LGALS8, anticorps 1200015E08Rik, anticorps AI326142, anticorps D13Ertd524e, anticorps Lgals-8, anticorps galectin-8, anticorps Gal-8, anticorps PCTA-1, anticorps PCTA1, anticorps Po66-CBP, anticorps xgalectin-VIIIa, anticorps galectin 8, anticorps lectin, galactose binding, soluble 8, anticorps lectin, galactoside binding soluble 8 S homeolog, anticorps LGALS8, anticorps Lgals8, anticorps lgals8.S
- Sujet
-
Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: Gal 8 antibody|Gal-8 antibody|Gal8 antibody|Galectin-8 antibody|galectin-8g antibody|Lectin galactoside binding soluble 8 antibody| LEG8_HUMAN antibody|LGAL S8 antibody|Lgals8 antibody|PCTA 1 antibody|PCTA-1 antibody|PCTA1 antibody|Po66 carbohydrate binding protein antibody|Po66 carbohydrate-binding protein antibody|Po66 CBP antibody|Po66-CBP antibody|Prostate carcinoma tumor antigen 1 antibody - ID gène
- 3964
- UniProt
- O00214
-