STXBP1 anticorps (N-Term)

N° du produit ABIN3043413

Détail du produit anti-STXBP1 anticorps

Antigène: STXBP1 (Syntaxin Binding Protein 1 (STXBP1))

Épitope: AA 184-216, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STXBP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KEYPAVRYRG EYKDNALLAQ LIQDKLDAYK ADD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 1
Protein Name: Syntaxin-binding protein 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur STXBP1

Antigène: STXBP1 (Syntaxin Binding Protein 1 (STXBP1))

Autre désignation: STXBP1 (STXBP1 Produits)

Synonymes: anticorps MUNC18-1, anticorps NSEC1, anticorps P67, anticorps RBSEC1, anticorps UNC18, anticorps AI317162, anticorps AI326233, anticorps MMS10-G, anticorps Ms10g, anticorps Munc-18a, anticorps Munc18-1, anticorps N-sec1, anticorps Rb-sec1, anticorps Sxtbp1, anticorps Unc18-1, anticorps Unc18h, anticorps nsec1, anticorps fj43h10, anticorps stxbp1, anticorps wu:fj36d12, anticorps wu:fj43h10, anticorps zgc:114171, anticorps rop, anticorps unc18, anticorps hunc18, anticorps rbsec1, anticorps munc18-1, anticorps MGC146482, anticorps ANC18HA, anticorps NSEC1A, anticorps Sec1, anticorps n-sec1, anticorps nSec1, anticorps rbSec1, anticorps rbSec1A, anticorps rbSec1B, anticorps UNC18A, anticorps si:rp71-10d23.3, anticorps syntaxin binding protein 1, anticorps syntaxin binding protein 1a, anticorps syntaxin binding protein 1 L homeolog, anticorps syntaxin binding protein 1b, anticorps STXBP1, anticorps Stxbp1, anticorps stxbp1a, anticorps stxbp1, anticorps Tb09.160.0780, anticorps stxbp1.L, anticorps stxbp1b

Sujet: Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.

Synonyms: FLJ37475 antibody|Munc 18 1 antibody|Munc 18a antibody|MUNC18 1 antibody|N-Sec1 antibody|Neuronal SEC1 antibody|NSec1 antibody|p67 antibody|Protein unc-18 homolog 1 antibody|Protein unc-18 homolog A antibody|Rb sec1 antibody|RBSEC1 antibody|STXB1_HUMAN antibody| STXBP1 antibody|Syntaxin binding protein 1 antibody|Syntaxin-binding protein 1 antibody|Unc 18 homolog antibody|Unc 18A antibody|Unc-18A antibody|Unc18 1 antibody|UNC18 antibody|Unc18-1 antibody

ID gène: 6812

UniProt: P61764

Pathways: Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport