Transferrin anticorps (N-Term)

N° du produit ABIN3043419

Détail du produit anti-Transferrin anticorps

Antigène: Transferrin (TF)

Épitope: AA 20-49, N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Transferrin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: VPDKTVRWCA VSEHEATKCQ SFRDHMKSVI

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: transferrin
Protein Name: Serotransferrin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Transferrin (ABIN3043419)

Da, Zhuo, Qian: "MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC." dans: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10625-34, (2016) (PubMed).

Wang, Hu, Tang, Wang, Sun, Chen, Yin, Xue, Sun: "Effect Comparison of Both Iron Chelators on Outcomes, Iron Deposit, and Iron Transporters After Intracerebral Hemorrhage in Rats." dans: Molecular neurobiology, (2015) (PubMed).

Liang, Zhang, Zhao, Li, Yang, Liang, Ceng: "A study of the ultrasound-targeted microbubble destruction based triplex-forming oligodexinucleotide delivery system to inhibit tissue factor expression." dans: Molecular medicine reports, Vol. 11, Issue 2, pp. 903-9, (2014) (PubMed).

Chen, Li, Jiang, Zhang, Zhang, Jiang, He, Li: "Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma." dans: Oncology reports, Vol. 32, Issue 2, pp. 755-63, (2014) (PubMed).

Zhu, Lv, Chen, Wang, Zhong: "Protective effect and mechanism of sodium tanshinone II A sulfonate on microcirculatory disturbance of small intestine in rats with sepsis." dans: Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban, Vol. 31, Issue 4, pp. 441-5, (2011) (PubMed).

Chen, Luo, Tan, Wei, Wu, Zheng, Zhang, Xu: "Immunolocalisation of tissue factor in esophageal cancer is correlated with intratumoral angiogenesis and prognosis of the patient." dans: Acta histochemica, Vol. 112, Issue 3, pp. 233-9, (2010) (PubMed).

Détails sur Transferrin

Antigène: Transferrin (TF)

Autre désignation: Transferrin (TF Produits)

Synonymes: anticorps ltf, anticorps pro1557, anticorps pro2086, anticorps mgc107777, anticorps LOC692564, anticorps TF, anticorps LOC100144362, anticorps tf, anticorps LTF, anticorps TFEW, anticorps conalbumin, anticorps tf-b, anticorps MGC64306, anticorps PRO1557, anticorps PRO2086, anticorps TFQTL1, anticorps AI266983, anticorps Cd176, anticorps HP, anticorps Tf, anticorps Tfn, anticorps hpx, anticorps Trf, anticorps cb285, anticorps gavi, anticorps id:ibd3238, anticorps id:ibd3525, anticorps sb:cb285, anticorps wu:fb57g06, anticorps wu:fb62h02, anticorps wu:fb63h10, anticorps wu:fb64h10, anticorps zgc:112154, anticorps 143958_at, anticorps CG6186, anticorps Dmel\\CG6186, anticorps TSF1, anticorps anon-EST:Posey265, anticorps tsf1, anticorps Pro-TRH, anticorps IL-5, anticorps STF I, anticorps TRF1, anticorps sTF1, anticorps sTf, anticorps tf1, anticorps transferrin, anticorps serotransferrin, anticorps transferrin (ovotransferrin), anticorps transferrin L homeolog, anticorps melanotransferrin, anticorps transferrin-a, anticorps Transferrin 1, anticorps thyrotropin releasing hormone, anticorps interleukin 5, anticorps TF, anticorps LOC477072, anticorps tf, anticorps Tf, anticorps LOC100144362, anticorps tf.L, anticorps LOC5575625, anticorps Trf, anticorps tfa, anticorps Tsf1, anticorps TRH, anticorps IL5, anticorps LOC101085148, anticorps LOC100726872, anticorps trf

Sujet: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1 % (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 M-1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

Synonyms: Apotransferrin antibody|Beta 1 metal binding globulin antibody|Beta-1 metal-binding globulin antibody|DKFZp781D0156 antibody|PRO1400 antibody|PRO1557 antibody|PRO2086 antibody|Serotransferrin antibody|Serotransferrin precursor antibody|Siderophilin antibody|TF antibody|TFQTL1 antibody|Transferin antibody|Transferrin antibody

ID gène: 7018

UniProt: P02787

Pathways: Transition Metal Ion Homeostasis