RUNX2 anticorps (Middle Region)
-
- Antigène Voir toutes RUNX2 Anticorps
- RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
-
Épitope
- AA 244-278, Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RUNX2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
- Séquence
- DRLSDLGRIP HPSMRVGVPP QNPRPSLNSA PSPFN
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
Gene Name: runt-related transcription factor 2
Protein Name: Runt-related transcription factor 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product RUNX2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for RUNX2 is approximately 0.25 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
MicroRNA-214 Suppresses Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting ATF4." dans: Stem cells international, Vol. 2017, pp. 3028647, (2017) (PubMed).
: "Effects of Intermittent Administration of Parathyroid Hormone (1-34) on Bone Differentiation in Stromal Precursor Antigen-1 Positive Human Periodontal Ligament Stem Cells." dans: Stem cells international, Vol. 2016, pp. 4027542, (2016) (PubMed).
: "Pulsed electromagnetic fields protect the balance between adipogenesis and osteogenesis on steroid-induced osteonecrosis of femoral head at the pre-collapse stage in rats." dans: Bioelectromagnetics, Vol. 35, Issue 3, pp. 170-80, (2014) (PubMed).
: "The time-dependent manner of sinusoidal electromagnetic fields on rat bone marrow mesenchymal stem cells proliferation, differentiation, and mineralization." dans: Cell biochemistry and biophysics, Vol. 69, Issue 1, pp. 47-54, (2014) (PubMed).
: "Mechanical stress stimulates the osteo/odontoblastic differentiation of human stem cells from apical papilla via erk 1/2 and JNK MAPK pathways." dans: BioMed research international, Vol. 2014, pp. 494378, (2014) (PubMed).
: "Lithium chloride promotes the odontoblast differentiation of hair follicle neural crest cells by activating Wnt/?-catenin signaling." dans: Cell biology international, (2014) (PubMed).
: "IGF1 promotes osteogenic differentiation of mesenchymal stem cells derived from rat bone marrow by increasing TAZ expression." dans: Biochemical and biophysical research communications, Vol. 433, Issue 2, pp. 226-31, (2013) (PubMed).
: "Insulin-like growth factor 1 can promote the osteogenic differentiation and osteogenesis of stem cells from apical papilla." dans: Stem cell research, Vol. 8, Issue 3, pp. 346-56, (2012) (PubMed).
: "Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbfα-1 pathway." dans: Journal of Zhejiang University. Science. B, Vol. 11, Issue 12, pp. 905-11, (2010) (PubMed).
: "
-
MicroRNA-214 Suppresses Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting ATF4." dans: Stem cells international, Vol. 2017, pp. 3028647, (2017) (PubMed).
-
- Antigène
- RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
- Autre désignation
- RUNX2 (RUNX2 Produits)
- Synonymes
- anticorps AML3, anticorps CBF-alpha-1, anticorps CBFA1, anticorps CCD, anticorps CCD1, anticorps CLCD, anticorps OSF-2, anticorps OSF2, anticorps PEA2aA, anticorps PEBP2aA, anticorps Cbf, anticorps Cbfa-1, anticorps Cbfa1, anticorps LS3, anticorps Osf2, anticorps Pebp2a1, anticorps Pebpa2a, anticorps runx2, anticorps RUNX2, anticorps ccd, anticorps aml3, anticorps ccd1, anticorps osf2, anticorps cbfa1, anticorps pea2aa, anticorps pebp2a1, anticorps pebp2a2, anticorps pebp2aa, anticorps pebp2aa1, anticorps runt related transcription factor 2, anticorps runt-related transcription factor 2a, anticorps runt-related transcription factor 2, anticorps runt related transcription factor 2 L homeolog, anticorps RUNX2, anticorps runx2a, anticorps Runx2, anticorps runx2, anticorps LOC703331, anticorps LOC100549663, anticorps runx2.L
- Sujet
-
Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.
Synonyms: Acute myeloid leukemia 3 protein antibody|Alpha subunit 1 antibody|AML3 antibody|CBF alpha 1 antibody|CBF-alpha-1 antibody|CBFA1 antibody|CCD antibody|CCD1 antibody|Cleidocranial dysplasia 1 antibody|Core binding factor antibody|Core binding factor runt domain alpha subunit 1 antibody|Core binding factor subunit alpha 1 antibody|Core-binding factor subunit alpha-1 antibody|MGC120022 antibody|MGC120023 antibody|Oncogene AML 3 antibody|Oncogene AML-3 antibody|OSF 2 antibody|OSF-2 antibody|OSF2 antibody|Osteoblast specific transcription factor 2 antibody|Osteoblast-specific transcription factor 2 antibody|OTTHUMP00000016533 antibody|PEA2 alpha A antibody|PEA2-alpha A antibody|PEA2aA antibody|PEBP2 alpha A antibody|PEBP2-alpha A antibody|PEBP2A1 antibody|PEBP2A2 antibody|PEBP2aA antibody|PEBP2aA antibody|PEBP2aA1 antibody|Polyomavirus enhancer binding protein 2 alpha A subunit antibody|Polyomavirus enhancer-binding protein 2 alpha A subunit antibody|Runt domain antibody|Runt related transcription factor 2 antibody|Runt-related transcription factor 2 antibody|RUNX2 antibody|RUNX2_HUMAN antibody|SL3 3 enhancer factor 1 alpha A subunit antibody|SL3-3 enhancer factor 1 alpha A subunit antibody|SL3/AKV core binding factor alpha A subunit antibody|SL3/AKV core-binding factor alpha A subunit antibody - ID gène
- 860
- UniProt
- Q13950
-