Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

RUNX2 anticorps (Middle Region)

RUNX2 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043428
  • Antigène Voir toutes RUNX2 Anticorps
    RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
    Épitope
    • 23
    • 16
    • 9
    • 7
    • 7
    • 7
    • 7
    • 7
    • 5
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 244-278, Middle Region
    Reactivité
    • 146
    • 75
    • 52
    • 10
    • 9
    • 8
    • 8
    • 7
    • 7
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Humain
    Hôte
    • 136
    • 12
    Lapin
    Clonalité
    • 129
    • 19
    Polyclonal
    Conjugué
    • 60
    • 12
    • 8
    • 6
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Cet anticorp RUNX2 est non-conjugé
    Application
    • 93
    • 49
    • 31
    • 26
    • 11
    • 10
    • 9
    • 7
    • 3
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
    Séquence
    DRLSDLGRIP HPSMRVGVPP QNPRPSLNSA PSPFN
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
    Gene Name: runt-related transcription factor 2
    Protein Name: Runt-related transcription factor 2
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
    Isotype
    IgG
    Top Product
    Discover our top product RUNX2 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for RUNX2 is approximately 0.25 ng/lane under reducing conditions.
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Yao, Zhao, Ou, Liang, Lin, Wang: "MicroRNA-214 Suppresses Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting ATF4." dans: Stem cells international, Vol. 2017, pp. 3028647, (2017) (PubMed).

    Wang, Wang, Dai, Chen, Yang, Dai, Ou, Wang, Lin: "Effects of Intermittent Administration of Parathyroid Hormone (1-34) on Bone Differentiation in Stromal Precursor Antigen-1 Positive Human Periodontal Ligament Stem Cells." dans: Stem cells international, Vol. 2016, pp. 4027542, (2016) (PubMed).

    Li, Chen, Peng, Zhou, Fang: "Pulsed electromagnetic fields protect the balance between adipogenesis and osteogenesis on steroid-induced osteonecrosis of femoral head at the pre-collapse stage in rats." dans: Bioelectromagnetics, Vol. 35, Issue 3, pp. 170-80, (2014) (PubMed).

    Song, Yu, Zhao, Wei, Liu, Hu, Zhao, Yang, Wu: "The time-dependent manner of sinusoidal electromagnetic fields on rat bone marrow mesenchymal stem cells proliferation, differentiation, and mineralization." dans: Cell biochemistry and biophysics, Vol. 69, Issue 1, pp. 47-54, (2014) (PubMed).

    Mu, Lv, Wang, Ma, Ma, Liu, Yu, Mu: "Mechanical stress stimulates the osteo/odontoblastic differentiation of human stem cells from apical papilla via erk 1/2 and JNK MAPK pathways." dans: BioMed research international, Vol. 2014, pp. 494378, (2014) (PubMed).

    Shan, Zhou, Yang, Yan, Zhang, Fu, Jiang: "Lithium chloride promotes the odontoblast differentiation of hair follicle neural crest cells by activating Wnt/?-catenin signaling." dans: Cell biology international, (2014) (PubMed).

    Xue, Wu, Zhou, Ma, Wang, Liu, Ma, Li: "IGF1 promotes osteogenic differentiation of mesenchymal stem cells derived from rat bone marrow by increasing TAZ expression." dans: Biochemical and biophysical research communications, Vol. 433, Issue 2, pp. 226-31, (2013) (PubMed).

    Wang, Mu, Fan, Yu, Yan, Lei, Tang, Wang, Zheng, Yu, Zhang: "Insulin-like growth factor 1 can promote the osteogenic differentiation and osteogenesis of stem cells from apical papilla." dans: Stem cell research, Vol. 8, Issue 3, pp. 346-56, (2012) (PubMed).

    Liu, Zhong, Liang, Fu, Luo, Zhou, Gou, Huang: "Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbfα-1 pathway." dans: Journal of Zhejiang University. Science. B, Vol. 11, Issue 12, pp. 905-11, (2010) (PubMed).

  • Antigène
    RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))
    Autre désignation
    RUNX2 (RUNX2 Produits)
    Synonymes
    anticorps AML3, anticorps CBF-alpha-1, anticorps CBFA1, anticorps CCD, anticorps CCD1, anticorps CLCD, anticorps OSF-2, anticorps OSF2, anticorps PEA2aA, anticorps PEBP2aA, anticorps Cbf, anticorps Cbfa-1, anticorps Cbfa1, anticorps LS3, anticorps Osf2, anticorps Pebp2a1, anticorps Pebpa2a, anticorps runx2, anticorps RUNX2, anticorps ccd, anticorps aml3, anticorps ccd1, anticorps osf2, anticorps cbfa1, anticorps pea2aa, anticorps pebp2a1, anticorps pebp2a2, anticorps pebp2aa, anticorps pebp2aa1, anticorps runt related transcription factor 2, anticorps runt-related transcription factor 2a, anticorps runt-related transcription factor 2, anticorps runt related transcription factor 2 L homeolog, anticorps RUNX2, anticorps runx2a, anticorps Runx2, anticorps runx2, anticorps LOC703331, anticorps LOC100549663, anticorps runx2.L
    Sujet
    Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.

    Synonyms: Acute myeloid leukemia 3 protein antibody|Alpha subunit 1 antibody|AML3 antibody|CBF alpha 1 antibody|CBF-alpha-1 antibody|CBFA1 antibody|CCD antibody|CCD1 antibody|Cleidocranial dysplasia 1 antibody|Core binding factor antibody|Core binding factor runt domain alpha subunit 1 antibody|Core binding factor subunit alpha 1 antibody|Core-binding factor subunit alpha-1 antibody|MGC120022 antibody|MGC120023 antibody|Oncogene AML 3 antibody|Oncogene AML-3 antibody|OSF 2 antibody|OSF-2 antibody|OSF2 antibody|Osteoblast specific transcription factor 2 antibody|Osteoblast-specific transcription factor 2 antibody|OTTHUMP00000016533 antibody|PEA2 alpha A antibody|PEA2-alpha A antibody|PEA2aA antibody|PEBP2 alpha A antibody|PEBP2-alpha A antibody|PEBP2A1 antibody|PEBP2A2 antibody|PEBP2aA antibody|PEBP2aA antibody|PEBP2aA1 antibody|Polyomavirus enhancer binding protein 2 alpha A subunit antibody|Polyomavirus enhancer-binding protein 2 alpha A subunit antibody|Runt domain antibody|Runt related transcription factor 2 antibody|Runt-related transcription factor 2 antibody|RUNX2 antibody|RUNX2_HUMAN antibody|SL3 3 enhancer factor 1 alpha A subunit antibody|SL3-3 enhancer factor 1 alpha A subunit antibody|SL3/AKV core binding factor alpha A subunit antibody|SL3/AKV core-binding factor alpha A subunit antibody
    ID gène
    860
    UniProt
    Q13950
Vous êtes ici:
Support technique