POR anticorps (C-Term)

N° du produit ABIN3043443

Détail du produit anti-POR anticorps

Antigène: POR (P450 (Cytochrome) Oxidoreductase (POR))

Épitope: AA 633-668, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: RNMARDVQNT FYDIVAELGA MEHAQAVDYI KKLMTK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: P450 (cytochrome) oxidoreductase
Protein Name: NADPH--cytochrome P450 reductase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur POR

Antigène: POR (P450 (Cytochrome) Oxidoreductase (POR))

Autre désignation: POR (POR Produits)

Synonymes: anticorps CPR, anticorps CYPOR, anticorps P450R, anticorps POR, anticorps CCR, anticorps CG11567, anticorps DMR, anticorps DmCPR, anticorps Dmel\\CG11567, anticorps NCPR, anticorps P450, anticorps cpr, anticorps zgc:110032, anticorps npr, anticorps xpor, anticorps 4933424M13Rik, anticorps PORCINO, anticorps T5J17.90, anticorps T5J17_90, anticorps TFC C, anticorps TUBULIN-FOLDING COFACTOR C, anticorps cytochrome p450 oxidoreductase, anticorps P450 (cytochrome) oxidoreductase, anticorps ADP-ribosylation factor interacting protein 2, anticorps Cytochrome P450 reductase, anticorps P450 (cytochrome) oxidoreductase a, anticorps P450 (cytochrome) oxidoreductase L homeolog, anticorps NADPH--cytochrome P450 reductase, anticorps C-CAP/cofactor C-like domain-containing protein, anticorps POR, anticorps Arfip2, anticorps Por, anticorps Cpr, anticorps pora, anticorps por.L, anticorps LOC100406157, anticorps por, anticorps LOC100619047

Sujet: POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Synonyms: CPR antibody|CYPOR antibody|DKFZp686G04235 antibody|FLJ26468 antibody|NADPH Cytochrome P450 Reductase antibody|NADPH dependent cytochrome P450 reductase antibody|NADPH--cytochrome P450 reductase antibody|NCPR_HUMAN antibody|P450 (cytochrome) oxidoreductase antibody|P450 Cytochrome Oxidoreductase antibody|P450R antibody|POR antibody

ID gène: 5447

UniProt: P16435

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, SARS-CoV-2 Protein Interactome