LYZ anticorps (C-Term)
-
- Antigène Voir toutes LYZ Anticorps
- LYZ (Lysozyme (LYZ))
-
Épitope
- AA 106-141, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LYZ est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Lysozyme C(LYZ) detection. Tested with WB, IHC-P in Human,Rat.
- Séquence
- NIADAVACAK RVVRDPQGIR AWVAWRNRCQ NRDVRQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Lysozyme C(LYZ) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: lysozyme
Protein Name: Lysozyme C - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
- Isotype
- IgG
- Top Product
- Discover our top product LYZ Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats." dans: World journal of gastroenterology, Vol. 13, Issue 26, pp. 3592-7, (2007) (PubMed).
: "
-
Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats." dans: World journal of gastroenterology, Vol. 13, Issue 26, pp. 3592-7, (2007) (PubMed).
-
- Antigène
- LYZ (Lysozyme (LYZ))
- Autre désignation
- LYZ (LYZ Produits)
- Synonymes
- anticorps LZM, anticorps 1, anticorps LYZC, anticorps lys-C, anticorps zgc:136734, anticorps BmLys, anticorps LYS, anticorps LZ, anticorps LYZS, anticorps lysozyme C, anticorps LYZ, anticorps lysozyme, anticorps lysozyme, anticorps lysozyme (renal amyloidosis), anticorps lysozyme L homeolog, anticorps serum lysozyme, anticorps LYZ, anticorps lyz, anticorps Lzm, anticorps LOC781146, anticorps lyz.L, anticorps S-LZ
- Sujet
-
In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
Synonyms: 1 4 beta n acetylmuramidase c antibody|1 antibody|4-beta-N-acetylmuramidase C antibody|EC 3.2.1.17 antibody|LYSC_HUMAN antibody| Lysosyme antibody|Lysozyme (renal amyloidosis) antibody|Lysozyme C antibody|Lysozyme C precursor antibody|Lyz antibody|LZM antibody| Renal amyloidosis antibody - ID gène
- 4069
- UniProt
- P61626
-