BMP2 anticorps (C-Term)
-
- Antigène Voir toutes BMP2 Anticorps
- BMP2 (Bone Morphogenetic Protein 2 (BMP2))
-
Épitope
- AA 283-312, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BMP2 est non-conjugé
-
Application
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
- Séquence
- QAKHKQRKRL KSSCKRHPLY VDFSDVGWND
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
Gene Name: bone morphogenetic protein 2
Protein Name: Bone morphogenetic protein 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product BMP2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Effects of rhBMP-2 gene transfection to periodontal ligament cells on osteogenesis." dans: Bioscience reports, Vol. 37, Issue 3, (2018) (PubMed).
: "Hyaluronic acid-induced capacitation involves protein kinase C and tyrosine kinase activity modulation with a lower oxidative metabolism in cryopreserved bull sperm." dans: Theriogenology, Vol. 122, pp. 68-73, (2018) (PubMed).
: "Diabetes mellitus affects the biomechanical function of the callus and the expression of TGF-beta1 and BMP2 in an early stage of fracture healing." dans: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 49, Issue 1, pp. e4736, (2016) (PubMed).
: "Bone morphogenic protein-2 regulates the myogenic differentiation of PMVECs in CBDL rat serum-induced pulmonary microvascular remodeling." dans: Experimental cell research, Vol. 336, Issue 1, pp. 109-18, (2015) (PubMed).
: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." dans: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
: "In vitro and in vivo evaluations on osteogenesis and biodegradability of a β-tricalcium phosphate coated magnesium alloy." dans: Journal of biomedical materials research. Part A, Vol. 100, Issue 2, pp. 293-304, (2014) (PubMed).
: "Proliferative effect and osteoinductive potential of extracellular matrix coated on cell culture plates." dans: SpringerPlus, Vol. 2, Issue 1, pp. 303, (2014) (PubMed).
: "A comparison of osteocyte bioactivity in fine particulate bone powder grafts vs larger bone grafts in a rat bone repair model." dans: Acta histochemica, Vol. 116, Issue 6, pp. 1015-21, (2014) (PubMed).
: "Sodium thiosulfate protects human aortic smooth muscle cells from osteoblastic transdifferentiation via high-level phosphate." dans: The Kaohsiung journal of medical sciences, Vol. 29, Issue 11, pp. 587-93, (2013) (PubMed).
: "Using poly(lactic-co-glycolic acid) microspheres to encapsulate plasmid of bone morphogenetic protein 2/polyethylenimine nanoparticles to promote bone formation in vitro and in vivo." dans: International journal of nanomedicine, Vol. 8, pp. 2985-95, (2013) (PubMed).
: "Enhancement of the osseointegration of a polyethylene terephthalate artificial ligament graft in a bone tunnel using 58S bioglass." dans: International orthopaedics, Vol. 36, Issue 1, pp. 191-7, (2012) (PubMed).
: "The effect of core decompression on local expression of BMP-2, PPAR-γ and bone regeneration in the steroid-induced femoral head osteonecrosis." dans: BMC musculoskeletal disorders, Vol. 13, pp. 142, (2012) (PubMed).
: "Effects of huogu I formula (I) on correlated factors of bone regeneration in chickens with steroid-induced necrosis of femoral head." dans: Chinese journal of integrative medicine, Vol. 18, Issue 5, pp. 378-84, (2012) (PubMed).
: "Transfer of bone-marrow-derived mesenchymal stem cells influences vascular remodeling and calcification after balloon injury in hyperlipidemic rats." dans: Journal of biomedicine & biotechnology, Vol. 2012, pp. 165296, (2012) (PubMed).
: "Synergistic enhancement of new bone formation by recombinant human bone morphogenetic protein-2 and osteoprotegerin in trans-sutural distraction osteogenesis: a pilot study in dogs." dans: Journal of oral and maxillofacial surgery : official journal of the American Association of Oral and Maxillofacial Surgeons, Vol. 69, Issue 11, pp. e446-55, (2011) (PubMed).
: "Ectopic osteogenesis of hBMP-2 gene-transduced human bone mesenchymal stem cells/BCB." dans: Connective tissue research, Vol. 51, Issue 4, pp. 274-81, (2010) (PubMed).
: "Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbfα-1 pathway." dans: Journal of Zhejiang University. Science. B, Vol. 11, Issue 12, pp. 905-11, (2010) (PubMed).
: "Expression of bone morphogenetic protein-2 and its receptors in epithelial ovarian cancer and their influence on the prognosis of ovarian cancer patients." dans: Journal of experimental & clinical cancer research : CR, Vol. 29, pp. 85, (2010) (PubMed).
: "Construction and expression of a bicistronic vector containing human bone morphogenetic protein 2 and vascular endothelial growth factor-165 genes in vitro." dans: Chinese medical journal, Vol. 122, Issue 4, pp. 471-3, (2009) (PubMed).
: "Bone morphogenetic protein-2: a potential regulator in scleral remodeling." dans: Molecular vision, Vol. 14, pp. 2373-80, (2008) (PubMed).
: "
-
Effects of rhBMP-2 gene transfection to periodontal ligament cells on osteogenesis." dans: Bioscience reports, Vol. 37, Issue 3, (2018) (PubMed).
-
- Antigène
- BMP2 (Bone Morphogenetic Protein 2 (BMP2))
- Autre désignation
- BMP2 (BMP2 Produits)
- Synonymes
- anticorps BDA2, anticorps BMP2A, anticorps AI467020, anticorps Bmp2a, anticorps BMP-2, anticorps xBMP-2, anticorps xbmp2, anticorps BMP2, anticorps bmp2a, anticorps bmp2, anticorps wu:fc59d09, anticorps bone morphogenetic protein 2, anticorps bone morphogenetic protein 2 L homeolog, anticorps Bone morphogenetic protein 2, anticorps bone morphogenetic protein 2a, anticorps BMP2, anticorps Bmp2, anticorps bmp2.L, anticorps bmp2, anticorps bmp2a
- Sujet
-
BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. BMP-2, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation and epithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.
Synonyms: BDA2 antibody|BMP-2 antibody|BMP-2A antibody|Bmp2 antibody|BMP2_HUMAN antibody|BMP2A antibody|Bone morphogenetic protein 2 antibody| Bone morphogenetic protein 2A antibody - ID gène
- 650
- UniProt
- P12643
- Pathways
- Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Regulation of Muscle Cell Differentiation, Growth Factor Binding, Positive Regulation of fat Cell Differentiation
-