BMP4 anticorps (C-Term)
-
- Antigène Voir toutes BMP4 Anticorps
- BMP4 (Bone Morphogenetic Protein 4 (BMP4))
-
Épitope
- AA 293-324, C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BMP4 est non-conjugé
-
Application
- Western Blotting (WB), ELISA
- Fonction
- Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human,Mouse.
- Séquence
- SPKHHSQRAR KKNKNCRRHS LYVDFSDVGW ND
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human,Mouse.
Gene Name: bone morphogenetic protein 4
Protein Name: Bone morphogenetic protein 4 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product BMP4 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." dans: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
: "Expansive effects of aorta-gonad-mesonephros-derived stromal cells on hematopoietic stem cells from embryonic stem cells." dans: Chinese medical journal, Vol. 118, Issue 23, pp. 1979-86, (2005) (PubMed).
: "
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." dans: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
-
- Antigène
- BMP4 (Bone Morphogenetic Protein 4 (BMP4))
- Autre désignation
- BMP4 (BMP4 Produits)
- Synonymes
- anticorps BMP2B, anticorps BMP2B1, anticorps MCOPS6, anticorps OFC11, anticorps ZYME, anticorps Bmp-4, anticorps Bmp2b, anticorps Bmp2b-1, anticorps Bmp2b1, anticorps BOMPR4A, anticorps bmp-4, anticorps zbmp-4, anticorps zgc:100779, anticorps BMP-4, anticorps XBMP-4, anticorps bmp2b, anticorps bmp2b1, anticorps bmp4, anticorps ofc11, anticorps xbmp4, anticorps zyme, anticorps BMP4, anticorps bone morphogenetic protein 4, anticorps bone morphogenetic protein 4 L homeolog, anticorps bone morphogenetic protein 4 S homeolog, anticorps BMP4, anticorps Bmp4, anticorps bmp4, anticorps bmp4.L, anticorps bmp4.S
- Sujet
-
Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Synonyms: BMP 2B antibody|BMP 4 antibody|BMP-2B antibody|BMP-4 antibody|BMP2B antibody|BMP2B1 antibody|BMP4 antibody|BMP4_HUMAN antibody|Bone morphogenetic protein 2B antibody|Bone morphogenetic protein 4 antibody|DVR4 antibody|MCOPS6 antibody|OFC11 antibody|ZYME antibody - ID gène
- 652
- UniProt
- P12644
- Pathways
- Steroid Hormone Mediated Signaling Pathway, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-