TRPV5 anticorps (C-Term)
-
- Antigène Voir toutes TRPV5 Anticorps
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
-
Épitope
- AA 580-610, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRPV5 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human,Rat.
- Séquence
- DTHWRVAQER DELWRAQVVA TTVMLERKLP R
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human,Rat.
Gene Name: transient receptor potential cation channel, subfamily V, member 5
Protein Name: Transient receptor potential cation channel subfamily V member 5 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product TRPV5 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
- Autre désignation
- TRPV5 (TRPV5 Produits)
- Synonymes
- anticorps CaT2, anticorps Ecac1, anticorps CAT2, anticorps ECAC1, anticorps OTRPC3, anticorps D630033B11, anticorps TRPV5, anticorps ECAC, anticorps cat2, anticorps xcat2, anticorps transient receptor potential cation channel, subfamily V, member 5, anticorps transient receptor potential cation channel subfamily V member 5, anticorps calcium transporter 2 L homeolog, anticorps Trpv5, anticorps TRPV5, anticorps LOC100011049, anticorps trpv5, anticorps cat2.L
- Sujet
-
Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.
Synonyms: Calcium transport protein 2 antibody|Calcium transporter 2 antibody|CAT 2 antibody|CAT2 antibody|ECAC 1 antibody|ECaC antibody|ECAC1 antibody|Epithelial calcium channel 1 antibody|Osm 9 like TRP channel 3 antibody|Osm-9-like TRP channel 3 antibody|OTRPC 3 antibody|OTRPC3 antibody|Transient receptor potential cation channel subfamily V member 5 antibody|TRPV 5 antibody|TrpV5 antibody|TRPV5_HUMAN antibody - ID gène
- 56302
-