Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Aquaporin 1 anticorps (C-Term)

AQP1 Reactivité: Humain, Rat, Souris WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043524
  • Antigène Voir toutes Aquaporin 1 (AQP1) Anticorps
    Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))
    Épitope
    • 17
    • 16
    • 12
    • 8
    • 6
    • 6
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 240-269, C-Term
    Reactivité
    • 89
    • 66
    • 60
    • 5
    • 5
    • 2
    • 2
    Humain, Rat, Souris
    Hôte
    • 96
    • 8
    • 2
    Lapin
    Clonalité
    • 90
    • 16
    Polyclonal
    Conjugué
    • 44
    • 11
    • 10
    • 7
    • 4
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp Aquaporin 1 est non-conjugé
    Application
    • 81
    • 42
    • 42
    • 24
    • 17
    • 16
    • 16
    • 15
    • 14
    • 13
    • 8
    • 2
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    DRVKVWTSGQ VEEYDLDADD INSRVEMKPK
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: aquaporin 1
    Protein Name: Aquaporin-1
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
    Isotype
    IgG
    Top Product
    Discover our top product AQP1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Zhang, Chen, Dong, Shi: "Effect of selective inhibition of aquaporin 1 on chemotherapy sensitivity of J82 human bladder cancer cells." dans: Oncology letters, Vol. 15, Issue 3, pp. 3864-3869, (2018) (PubMed).

    Li, Zhao, Miao, Xu, Xiao, Liu: "Dynamic expression and roles of sequestome‑1/p62 in LPS‑induced acute kidney injury in mice." dans: Molecular medicine reports, Vol. 17, Issue 6, pp. 7618-7626, (2018) (PubMed).

    Wang, Bu, Zhang, Chen, Zhang, Bao: "Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema." dans: Molecular medicine reports, Vol. 12, Issue 4, pp. 5625-32, (2016) (PubMed).

    Huo, Liu, Wang, Zhang, Wang, Yang, Sun, Xu: "Early hyperbaric oxygen therapy inhibits aquaporin 4 and adrenocorticotropic hormone expression in the pituitary gland of rabbits with blast-induced craniocerebral injury." dans: Neural regeneration research, Vol. 7, Issue 22, pp. 1729-35, (2015) (PubMed).

    Zhang, Wu, Yang, Liu, Liu: "Effects of dexmedetomidine on the protection of hyperoxia-induced lung injury in newborn rats." dans: International journal of clinical and experimental pathology, Vol. 8, Issue 6, pp. 6466-73, (2015) (PubMed).

    Ran, Wang, Chen, Zeng, Zhou, Zheng, Sun, Wang, Lv, Liang, Zhang, Liu: "Aquaporin-1 expression and angiogenesis in rabbit chronic myocardial ischemia is decreased by acetazolamide." dans: Heart and vessels, Vol. 25, Issue 3, pp. 237-47, (2010) (PubMed).

  • Antigène
    Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))
    Autre désignation
    AQP1 (AQP1 Produits)
    Synonymes
    anticorps fj33g04, anticorps zgc:85890, anticorps wu:fj33g04, anticorps AQP1, anticorps CHIP28, anticorps AQP-CHIP, anticorps CO, anticorps AQP-1, anticorps CHIP29, anticorps aquaporin 1a (Colton blood group), tandem duplicate 1, anticorps aquaporin 1, anticorps aquaporin 1 (Colton blood group), anticorps aqp1a.1, anticorps AQP1, anticorps Aqp1
    Sujet
    Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

    Synonyms: AQP 1 antibody|AQP CHIP antibody|AQP-1 antibody|AQP1 antibody|AQP1_HUMAN antibody|Aquaporin CHIP antibody|Aquaporin-1 antibody|Aquaporin-CHIP antibody|Aquaporin1 antibody|Channel forming integral protein 28 kDa antibody|Channel like integral membrane protein 28 kDa antibody|CHIP 28 antibody| CHIP28 antibody|CO antibody|Colton blood group antibody|Growth factor induced delayed early response protein antibody|MGC26324 antibody|Urine water channel antibody|Water channel protein CHIP 29 antibody|Water channel protein CHIP29 antibody|Water channel protein for red blood cells and kidney proximal tubule antibody
    ID gène
    358
    UniProt
    P29972
    Pathways
    Hormone Transport
Vous êtes ici:
Support technique