NQO1 anticorps (C-Term)
-
- Antigène Voir toutes NQO1 Anticorps
- NQO1 (NAD(P)H Dehydrogenase, Quinone 1 (NQO1))
-
Épitope
- AA 242-274, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NQO1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
- Séquence
- EVQDEEKNKK FGLSVGHHLG KSIPTDNQIK ARK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
Gene Name: NAD(P)H dehydrogenase, quinone 1
Protein Name: NAD(P)H dehydrogenase [quinone] 1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product NQO1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- NQO1 (NAD(P)H Dehydrogenase, Quinone 1 (NQO1))
- Autre désignation
- NQO1 (NQO1 Produits)
- Synonymes
- anticorps zgc:77191, anticorps wu:fb63c10, anticorps nqo1, anticorps DHQU, anticorps DIA4, anticorps DTD, anticorps NMOR1, anticorps NMORI, anticorps QR1, anticorps Dia4, anticorps AV001255, anticorps Dtd, anticorps Nmo-1, anticorps Nmo1, anticorps Nmor1, anticorps Ox-1, anticorps Ox1, anticorps Qr1, anticorps NADPH-d, anticorps NAD(P)H dehydrogenase, quinone 1, anticorps NAD(P)H quinone dehydrogenase 1, anticorps NAD(P)H dehydrogenase, quinone 1 L homeolog, anticorps nqo1, anticorps NQO1, anticorps Bpet2092, anticorps nqo1.L, anticorps Nqo1
- Sujet
-
This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms: Azoreductase antibody|Cytochrome b 5 reductase antibody|DHQU antibody|DIA 4 antibody|DIA4 antibody|Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody|Diaphorase (NADH/NADPH) antibody|Diaphorase 4 antibody|Dioxin inducible 1 antibody|DT diaphorase antibody|DT-diaphorase antibody|DTD antibody|Menadione reductase antibody|NAD(P)H dehydrogenase [quinone] 1 antibody|NAD(P)H dehydrogenase quinone 1 antibody|NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody|NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody|NAD(P)H:menadione oxidoreductase 1 antibody|NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody|NAD(P)H:quinone oxidoreductase 1 antibody| NAD(P)H:quinone oxireductase antibody|NMOR 1 antibody|NMOR I antibody|NMOR1 antibody|NMORI antibody|NQO 1 antibody|NQO1 antibody|NQO1_HUMAN antibody|Phylloquinone reductase antibody| QR 1 antibody|QR1 antibody|Quinone reductase 1 antibody - ID gène
- 1728
- UniProt
- P15559
-